KEGG   Macaca mulatta (rhesus monkey): 717572Help
Entry
717572            CDS       T01028                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc05144  Malaria
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    717572 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    717572 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    717572 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    717572 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    717572 (THBS3)
   05144 Malaria
    717572 (THBS3)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    717572 (THBS3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   717572 (THBS3)
  Exosomal proteins of colorectal cancer cells
   717572 (THBS3)
  Exosomal proteins of bladder cancer cells
   717572 (THBS3)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   717572 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 717572
NCBI-ProteinID: NP_001247443
Ensembl: ENSMMUG00000003902
UniProt: F6ZVD5
Position
1
AA seq 956 aa AA seqDB search
METQELRGALALLLLCSFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECVHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHVHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDVDSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctctttcgcatct
gccagtcaggacctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccctgctcactgctggggacatctacctcttgtcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacacgcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcaggcctggccgatggt
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgctctgcat
ctctatgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcagaggtcgatgggctggagattaggactggacagaaggcatatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcagtgaccaatgcactg
cactccattctaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccag
atcctggtggagctgcgggatgatatacgagaccaggtgaaggaaatgtccctgatccga
aacaccattatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aatccctgcttccgaggcgtggactgcatggaagtgtacgagtacccaggctaccgctgt
gggccctgtccccccggcctacagggcaacggcacccactgcagtgacatcaatgagtgt
gttcacgccgacccctgtttcccgggctccagctgcatcaacaccatgcccggcttccac
tgtgaggcctgtcctcgagggtacaagggcacacaggtgtctggtgtgggcattgactat
gcccgggccagcaaacaggtctgcaatgacatcgatgaatgcaacgatggcaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgc
cgcctgggtttcctgggcaaccagagccagggctgcctcccagcccggacctgccacagc
ccagcccacagtccctgccacgtccatgctcattgtctctttgaacgcaatggtgcagta
tcctgccagtgtaacgtgggctgggctgggaatgggaacgtatgtgggactgacacagac
atcgatggctatccagaccaagcactgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgacgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaagaccaacagaactcagatacagattcatttggtgatgcctgtgac
aattgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaacccactacagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgtcctgaaatgagcaatcctacccagacagatgtagacagcgacttggtgggggatgtc
tgtgataccaatgaagacagtgatggggatgggcatcaggacaccaaggacaactgccca
cagctgccaaatagctcccagctggactcagacaacgatggacttggagatgagtgtgat
ggggatgatgacaatgatggcatcccagattacgtgcctcctggtcctgataactgccgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgctgtggtcgaccccctggatgtgtgtcccgaaagtgcagag
gtaacgcttacggattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggttgtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccctggcttggcagttggatacacggccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgacgatgactacgcaggctttctcttcagttatcaagac
agtggccgattctacgtagtcatgtggaagcagactgagcagacctactggcaggctaca
ccctttcgggcggttgcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccgaaatgccctgtggcatactggccacacccctgatcaggtgcga
ctactgtggacggacccacgaaatgtgggctggcgggacaagacctcctatcgctggcag
cttctgcaccggcctcaagttggctacattcgggtgaagctctatgagggaccccagctt
gtggcggattctggggtgattattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttttcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagggtgtga

DBGET integrated database retrieval system