KEGG   Macaca mulatta (rhesus monkey): 717764Help
Entry
717764            CDS       T01028                                 

Gene name
PLCB3
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    717764 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    717764 (PLCB3)
   04310 Wnt signaling pathway
    717764 (PLCB3)
   04020 Calcium signaling pathway
    717764 (PLCB3)
   04070 Phosphatidylinositol signaling system
    717764 (PLCB3)
   04022 cGMP - PKG signaling pathway
    717764 (PLCB3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    717764 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    717764 (PLCB3)
   04062 Chemokine signaling pathway
    717764 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    717764 (PLCB3)
   04912 GnRH signaling pathway
    717764 (PLCB3)
   04915 Estrogen signaling pathway
    717764 (PLCB3)
   04921 Oxytocin signaling pathway
    717764 (PLCB3)
   04918 Thyroid hormone synthesis
    717764 (PLCB3)
   04919 Thyroid hormone signaling pathway
    717764 (PLCB3)
   04916 Melanogenesis
    717764 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    717764 (PLCB3)
   04270 Vascular smooth muscle contraction
    717764 (PLCB3)
  Digestive system
   04970 Salivary secretion
    717764 (PLCB3)
   04971 Gastric acid secretion
    717764 (PLCB3)
   04972 Pancreatic secretion
    717764 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    717764 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    717764 (PLCB3)
   04725 Cholinergic synapse
    717764 (PLCB3)
   04728 Dopaminergic synapse
    717764 (PLCB3)
   04726 Serotonergic synapse
    717764 (PLCB3)
   04720 Long-term potentiation
    717764 (PLCB3)
   04730 Long-term depression
    717764 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    717764 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    717764 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    717764 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    717764 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    717764 (PLCB3)
   05016 Huntington's disease
    717764 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    717764 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    717764 (PLCB3)
   05143 African trypanosomiasis
    717764 (PLCB3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     717764 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 1222 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPSGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQVLLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEGALEKPSLEPRKSLGE
EGLNRGPYALGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQEMCQDTQSQQL
GSQLSPNPTPSPLDASPRRPPGPTASPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLQSRQERDLRELRKKHQRKAVTLTCRLLDGLAQAQAEGRCRLRPVHVTDPSITQX
XXXXXXXXXXXELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNEREKK
ELQKILDRKRHNSISEAKTRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVA
GQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLGDGLLVACASNGH
APGSSGHLSGADSESQEENTQL
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcctaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccagtggcttcttcttgtactggacaggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgtctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccggacccagtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtccgaggagctgttcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcactggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggtgccaagggcaagccatac
ctgacactggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgccgctgcggccctcccaggcccgactgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaacggcatcctgcccctggaagccctggatctgagcgccgacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactgctgggcag
ctggccgggacctcgtcggtggagatgtaccgccaggtgctgctgtggggctgccgctgt
gtggagctggatgtgtggaaaggacggccgcccgaggaggaacccttcatcacccatggc
ttcaccatgaccacggaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctacccggtcatcctctccttcgagaaccacgtggactcggcaaag
cagcaggcaaagatggctgagtactgccgctccatctttggagatgcgctactcatcgag
cctctggacaagtacccgctggccccaggtgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcacagacccagcacaggtggcccagacagc
gccgggcgcaagcggccgctggagcagagcaattcggccctgagcgagagctccgctgcc
actgagccctcctccccgcagcttgggtcgcccagctctgacagctgcccaggcctgagc
aacggggaggagggggcccttgagaagcccagcctggagcctcggaagtctttgggtgag
gagggcctgaaccggggcccctatgctcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggagcagacagaccccaaaaagccgaccacagatgagggcacggcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaagctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaatgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggcctgacaaatccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctatccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggatgaggagccc
ttcgacttccccaaggtggtgctgcctacgttggcttcacttcgaatcgcagcctttgag
gaggggggtaaatttgtagggcaccggatcctgcctgtctctgccatccgctctgggtac
cactacgtctgcctgcggaacgaggccaaccagccgctgtgccttccggccctgctcatc
tacactgaagcctcggactacattcctgatgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagatgtgccaggacacccagtctcagcagctg
gggtctcagctgtccccaaaccccacccctagcccactggatgcctccccccgccggccc
cccggccccaccgcctcccctgccagcacctccctcagcagcccagggcagcgcgacgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccagagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacctgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccagttcatgtgacggacccaagcatcacccagann
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntggagctgcgggaggcccaggtggacgca
gaggcccagcggaggctggagcatctgagacaggctctgcagcggctcagggaggtcgtc
cttgatgcaaacacaactcagttcaagaggctgaaagagatgaacgagagggaaaagaag
gaactgcagaagatcctggacagaaagcgccataacagcatctcggaggccaagacgagg
gacaagcataagaaggaggcggaactgacggagattaaccgtcggcacatcactgagtca
gtcaactccatccgtcggctggaggaggcccagaagcagcggcatgaccgtcttgtggct
gggcagcagcaggtcctgcaacagctggcagaagaggagcccaagctgctggcccagctg
gcccaggagtgtcaggagcagcgggcgaggctcccccaggagatccgcaggagcctgctg
ggcgagatgccggaggggctgggggatgggcttctggtggcctgtgccagcaacggtcac
gcacctgggagcagcgggcacctgtcgggcgctgactcggagagccaggaggagaacacg
cagctctga

DBGET integrated database retrieval system