KEGG   Macaca mulatta (rhesus monkey): 717941Help
Entry
717941            CDS       T01028                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     717941 (DYRK2)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   717941 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 601 aa AA seqDB search
MLTRKPSAAAPAAFPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHPHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaggaaaccttcggccgccgctcccgccgccttcccgaccggcagaggtggg
gacagcgccgttcgccagcttcaggcttccccggggctcggtgcgggggccacccggagc
ggagtggggaccggcccgccctcccccatcgccctgccgcctctccgggccagcaacgct
gccgccgcagcccacacgattggcggcagtaagcacacaatgaatgatcacctgcatgtc
ggcagccaccctcatggacagatccaggttcaacagctgtttgaggataacagtaacaag
cggacagtgctcacgacacaaccaaatgggcttacaacagtgggcaaaacgggcttgcca
gtggtgccagagcggcagctggacagcattcatagacggcaggggagctccacgtctctg
aagtccatggaaggcatggggaaggtgaaagccacccccatgacacctgaacaagcaatg
aagcaatacatgcaaaaactcacagcctttgaacaccatgagattttcagctaccctgaa
atatatttcttgggtctaaatgctaagaagcgccagggcatgacaggtgggcccaacaat
ggtggctatgatgatgaccagggatcatatgtgcaggtgccccatgatcacgtggcttac
aggtacgaggtcctcaaggtcattgggaaggggagctttgggcaggtggtcaaggcctac
gatcacaaagtccaccagcacgtggccctaaagatggtgcggaatgagaagcgcttccac
aggcaagcagcagaggagatccgaatcctggaacacctgcggaagcaggacaaggataac
acaatgaatgtcatccatatgctggagaatttcaccttccgcaaccacatctgcatgacg
tttgagctgctgagcatgaacctctatgaactcatcaagaagaataaattccagggcttc
agcctgcctttggttcgcaagtttgcccactcgattctgcagtgcttggatgctttgcac
aaaaacagaataattcactgtgaccttaagcccgagaacattttgttaaagcagcagggt
agaagcggtattaaagtgattgattttggctccagttgttacgagcatcagcgtgtctac
acgtacatccagtcgcgtttttaccgggctccagaagtgatccttggggccaggtatggc
atgcccattgacatgtggagcctgggctgcattttagcagagctcctgacgggttacccc
ctcttgcctggggaggatgaaggggaccagctggcctgtatgattgaactgttgggcatg
ccctcacagaaactgctggatgcgtccaaacgagccaaaaattttgtgagctccaagggt
tacccccgttactgcactgtcacgactctctcagatggctctgtggtcctcaacggaggc
cgttcccggagggggaaactgaggggcccaccggagagcagagagtgggggaacgcgctg
aaggggtgtgacgatccccttttccttgacttcttaaaacagtgtttagagtgggatcct
gcagtgcgcatgaccccaggccaggctttgcggcacccctggctgaggaggcgattgcca
aagcctcccaccggggagaaaacgtcagtgaaaaggataactgagagcaccggtgctatc
acatctatatccaagttacctccaccttccagctcagcttccaaactgaggactaatttg
gcgcagatgacagatgccaacgggaatattcagcagaggacagtgttgccaaaactcgtt
agctga

DBGET integrated database retrieval system