KEGG   Macaca mulatta (rhesus monkey): 718028Help
Entry
718028            CDS       T01028                                 

Gene name
USP34, ENSA
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     718028 (USP34)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   718028 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 3489 aa AA seqDB search
MRDNPRISGEVSPAPSPLTSVKNLFLSSDELLIKISDVEGGDGLQLRKEHTLKIFTYINS
WTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQ
AEEPLNIDRECNEGSSERQKSIEKKSNSTRICNLTEEESSKSSDPFSLWSTDEKEKLLLC
VAKIFQIQFPLYTAYKHNTHPTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKN
GLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLS
DQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQ
LHTFNDVCNNESLVSDTETSIAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAA
EGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQT
LYLASMLIKALWNNALAAKAQLSKQSSFASLLNTNIPIGNKKEEEELRRTAPSPWSPAAS
PQSSDNSDTHQSGGSDIEMDEQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPG
SSSGHSDGSSNEVNSSHASHSAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGA
DLRNRKLESQAGICLGDSQGTSERNGTSSGTGKDLVFNTESLPSVDNRMRMLDACSHSED
PEHDISGEMNATHIAQGSQESCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHH
DGHMVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHL
PNLASIYHEHLSQGPVVHKHQFNSNAVTDINLDNVCKKGNTLLWDIVQDEDAVNLSEGLI
NEAEKLLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDT
HWITMWAEKELNMMKLFFDNLVYYIQTVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGS
PDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQL
KPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQY
INSYYINGKTGLEKEQEFISKCMESLMIASSSLEQESHSSLMVIERGLLMLKTHLEAFRR
RFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAE
VTHWYENLQKEQINQQAQLQEFGQSNRKGEFPGGLMGPVRMISSGHELTTDYDEKALHEL
GFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEML
ASFKPPSGKVAVDDSESLRCEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSN
DGFNWKELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENS
KNSWSCKFVAAGGLQQLLEIFNSGILEPKEQESWTVWQLDCLACLLKLICQFAVDPSDLD
LAYHDVFAWSGIAESHRKRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMS
VAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKL
TLLIPETAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDD
YEEEPMLKPGCKEYFWLLCKLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDG
NVEDDGLTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSS
RAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEXXXXXXXXYSEDMKH
KTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEM
SPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDT
LEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRL
DMTPYTEDFLMGKSERKEGFKEVNDHSKDSESYEYDLIGVTVHTGTADGGHYYSFIRDIV
NPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYM
LFYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPST
LPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADD
DWWPMQILIKCPNQIVRQLKGFFETLFLIICITETSDDMDASVEDIGGRSCVTRFVRTLL
LIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVE
VLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAALT
GGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFK
LLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNME
NWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLH
QVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQP
KLSEPAIATNHNKQALLSFWYNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVL
FNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQL
FIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFN
RGLILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQ
ERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNI
PMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSY
HQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIK
LLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCANLISTLITNL
ISQYQNLQSDFSNRVEISKASASLNGHIPHVILMTFREVSVLAYVFTDDEGATPVKRRRV
SSDEEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRM
EVPSSFSEDMSNIRSQHTEEQSSNGRYDDCKEFKDLHCSKDSTLAEEESEFPSTSISAVL
SDLADLRSCDGQPLPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRI
SGKGNQAAS
NT seq 10470 nt NT seq  +upstreamnt  +downstreamnt
atgagagataatcccagaataagtggcgaagtctcaccggccccctcaccccttacatct
gtcaaaaatctgttcttaagctcagatgagttattaattaaaatatcagatgtagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttacttatatcaattcc
tggacacagaggcaatgtctatgctgcttcaaggaatataagcatttggagatttttaat
caagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtgctccgggaccag
ctttgtaaacattgtactactattaacatagattccacgtggcaagatgagagtaatcaa
gcagaggaaccactgaatatagatagagagtgtaatgaaggaagttcagaaagacaaaaa
tcaatagaaaaaaaatcaaactctacaagaatttgtaatctgactgaggaggaatcttca
aagagttctgatccttttagtttatggagtacagatgagaaggaaaaactcttactatgt
gtggcaaaaatttttcaaattcagtttcccttatataccgcttacaagcataatactcac
cctactattgaggatatatcaactcaagaaagtaacatattaggggcattctgtgatatg
aatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatggaactcctgaaactttgccatttctt
atagcacatgcgtttattacagttgtgtctaatattagaatatggctacatattcctgct
gtcatgcagcacattataccttttaggacctatgttattaggtatttatgcaagctctct
gatcaggagttacgacagagtgcagctcgtaacatggctgacttaatgtggagcacagtg
aaagaaccactggatacaacattatgctttgataaagaaagcctagatcttgcatttaag
tactttatgtcacctactttgactatgaggttggctggattgagtcagataacaaatcaa
ctccataccttcaatgatgtgtgcaataatgaatcattagtatcagacacagaaacgtcc
attgcaaaagaacttgcagactggcttattagcaacaatgtggtggagcatatatttgga
ccaaatttacacattgagattatcaaacaatgccaagtgattttgaattttttggcagca
gaagggcgactaagtactcaacatattgactgcatttgggctgcagcacagttgaaacat
tgtagtcggtatatacatgacttatttccttcactcatcaagaatttggatccggtacca
cttagacatctacttaatctggtctcagctcttgagccaagtgttcatactgaacagaca
ttgtacttggcatccatgttaattaaagcactgtggaataatgcactagcagctaaggct
cagttatctaaacagagttcttttgcatctttattaaatactaatattcccattggaaat
aagaaagaagaagaagagctcagaagaacagctccatcaccttggtcacctgcagctagt
cctcaaagcagtgataatagcgatacacatcaaagtggaggtagtgacattgaaatggat
gagcagcttattaatagaaccaaacatgtgcaacaacgactttcagacacagaggaatcc
atgcagggaagttctgatgaaactgccaacagtggtgaagatggaagcagtggtcctggt
agcagtagtgggcatagtgatggatctagcaatgaggtcaattctagccatgcaagccat
tcagctgggagccctggcagtgaggtacagtcagaagacattgcagatattgaagccctc
aaagaagaagatgaagatgacgatcatggtcataatcctcccaaaagcagttgtggtgca
gatcttcggaatagaaagttagagagtcaagcaggcatttgcctgggggactcccaaggc
acgtcagaaagaaatgggacgagcagcggaacaggaaaggacctggtttttaacaccgaa
tcattgccgtcagtagataatcgaatgcgaatgctggatgcttgttcacactctgaagac
ccagaacacgatatttcaggggaaatgaatgctactcatatagcacaagggtctcaggag
tcttgtatcacgcgaactggggacttccttggggagactattgggaatgaattatttaat
tgtcgacaatttattggtccacagcatcaccaccaccaccaccaccatcaccaccaccat
gatgggcatatggttgatgatatgctaagtgcagatgatgtcagttgtagtagctcccag
gtcagtgcaaaatcagaaaaaaatatggctgattttgatggtgaagaatctggatgtgaa
gaggagctagttcagattaattcacatgcagaactgacgtctcacctccaacaacatctt
cccaatttagcttccatttaccatgaacatcttagtcaaggacctgtagttcataaacat
caattcaacagtaatgctgttacagacattaatttggataatgtttgcaagaaaggaaac
actttgttgtgggatatagtccaggatgaagatgcagttaatctttctgaaggattaata
aatgaagcagagaaacttctttgttcgttagtatgttggtttacagatagacagattcga
atgagattcattgaaggttgccttgaaaacttgggaaacaacagatcagtagtaatttca
cttcgtcttcttccaaaactatttggtacttttcagcagtttgggagcagttacgataca
cactggataacaatgtgggcagaaaaagaactgaacatgatgaagcttttctttgataat
ttggtatactacattcaaactgtgagagaaggaagacaaaaacatgcactgtacagccat
agtgctgaagttcaagttcgacttcaattcttgacttgtgtattttcaactctgggatca
cctgatcatttcaggttaagtttagagcaagttgacatcttatggcattgtttggtagag
gattctgaatgttatgatgatgcactccattggtttttaaatcaagttcgaagtaaagat
caacatgctatgggtatggaaacctacaaacatcttttcctggagaagatgccccagcta
aaacctgaaacaattagcatgactggcttaaacctgtttcagcatctctgtaacttggct
cgattggctaccagtgcctacgatggtggttcaaattctgagctgtgtggtatggaccaa
ttttggggcattgctttaagagcacaatctggtgatgtcagtcgagcagctatccagtat
attaactcctattatattaatggtaaaacgggtttggagaaggagcaagaatttattagt
aagtgcatggagagtcttatgatagcttctagcagtcttgagcaggaatcacactcaagt
ctcatggttatagaaagaggactccttatgctgaagacacatctggaagcgtttaggaga
aggtttgcatatcatctgagacagtggcaaattgaaggcactggtattagtagtcatttg
aaagcactgagtgacaaacagtctctgccgctaagggttgtatgccagccagctggactt
cctgacaagatgactattgaaatgtatcctagtgaccaggtagcagatcttagggctgaa
gtaactcattggtatgaaaatttacagaaagaacaaataaaccaacaagctcagcttcag
gagtttggtcaaagcaaccgaaaaggagagtttcctggaggcctcatgggacctgtcagg
atgatttcatctggacacgagttaacaacagattatgatgaaaaagcacttcatgagctt
ggttttaaggatatgcagatggtatttgtatctttgggtgcaccaaggagagagcggaaa
ggggaaggtgttcagctgccagcgtcttgcctcccaccccctcagaaggacaacattcca
atgcttttgcttttacaagaacctcatttaactactctttttgatttattagagatgctt
gcatcatttaaaccaccctcaggaaaagtagcagtggatgatagtgagagcttacgatgt
gaagaacttcatcttcatgcagaaaatctgtctaggcgggtctgggagctactgatgctt
cttcctacatgtcctaatatgttgatggcattccagaacatctcagatgagcagagtaat
gatggatttaattggaaagaacttctcaaaattaagagcgcccacaagctattgtatgct
ctggaaattattgaagcactgggaaaacctaatagaagaataaggagagagtcaacggga
agttacagtgatctttatccagattcagatgattcaagtgaggatcaagtggaaaatagt
aaaaattcctggagttgcaagtttgttgctgctggagggcttcaacagttactagaaatt
tttaattctggaattctagagcctaaagagcaggaatcatggacggtgtggcagctagac
tgtcttgcttgcttgctgaagttaatatgccagtttgcagtagatccctccgatttggat
ttagcttatcatgatgtcttcgcctggtctggtatagcggaaagccataggaaaagaacc
tggccaggcaaatcaaggaaggctgctggtgatcatgctaagggtcttcatataccacga
ttaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcgacttatgtct
gttgcttatacgtatgataatctggctcctagagttttaaaagctcagtctgatcacagg
tctagacatgaagtttcacattattcaatgtggctcttggtgagttgggctcattgctgt
tctttagtgaaatctagccttgctgatagtgatcatttacaagattggctaaagaaattg
actctccttattcctgagactgcagttcgtcatgaatcatgcaatggtctttataagtta
tccctgtcagggctggatggaggagactcaatcaatcgttcttttctgctcttggctgcc
tcaacattattgaaatttcttcctgatgctcaagcactcaaacctattaggatagatgat
tatgaggaagaaccaatgttaaaaccaggatgtaaagagtatttttggttgttatgcaaa
ttagttgacaacatacatataaaggacgctagtcagacaacgctcctcgacttagatgcc
ttggcaagacatttggctgactgtattagaagtagggagatccttgatcatcaggatggt
aatgtagaagatgatgggcttacaggactcctaaggcttgcaacaagtgtaattaaacac
aaaccaccctttaaattttcaagggaaggacaggaatttttgagagatatcttcaatctc
ctgtttttgttgccaagtctaaaggaccgacaacagccaaagtgcaaatcacattcttca
agagctgctgcttacgatttgttagtagagatggtaaaggggtctgttgagaactacagg
ctaatacacaactgggttatggcacaacacatgcagtcccatgcaccttataaatgggat
tactggcctcatgaannnnnnnnnnnnnnnnnnnnnnnntattcagaggatatgaagcac
aagactactcttctggagcttcagaaaatgtttacatatttaatggagagtgaatgcaaa
gcatataatcctagacctttctgtaaaacatacaccatggataagcagcctctgaatact
ggggaacagaaagatatgacagagttttttactgatctgattaccaaaatcgaagaaatg
tctccagaactgaaaaatactgtcaaaagtttatttggaggtgtaattacaaacaatgtt
gtatccttggattgtgaacatgttagtcaaactgctgaagagttttatactgtgaggtgc
caagtggctgatatgaagaacatttatgaatctcttgatgaagttactataaaagacact
ttggaaggtgataacatgtatacttgttctcattgtgggaagaaagtacgagccgaaaaa
agggcatgttttaagaaattgcctcgcattttgagtttcaatactatgagatacacattt
aatatggtcacgatgatgaaagagaaagtgaatacacacttttccttcccattacgtttg
gacatgacgccctatacagaagattttcttatgggaaagagtgagaggaaagaaggtttt
aaagaagtcaatgatcattcaaaagactcagagagctatgaatatgacttgataggagtg
actgttcacacaggaacggcagatggtggacactattatagctttatcagagatatagta
aatcctcatgcttataaaaacaataaatggtatctttttaatgatgctgaggtaaaacct
tttgattctgctcagcttgcatctgaatgttttggtggagagatgacgaccaagacctat
gattctgttacagataaatttatggatttctcttttgaaaagacacacagtgcatatatg
ctgttttacaaacgcatggaaccagaggaagaaaatggcagagaatacaaatttgatgtt
tcgtcagagttactagagtggatttggcatgataacatgcagtttcttcaagacaaaaac
atttttgaacatacatattttggatttatgtggcaattgtgtagttgtattcccagtaca
ttaccagatcctaaagctgtgtccctaatgacagcaaagttaagcacttcctttgtcctt
gagacatttattcattctaaagaaaagcccacaatgcttcagtggattgaactgttgacc
aaacagtttaataatagtcaggcagcttgtgagtggtttttagatcgcatggctgatgat
gactggtggccaatgcagatactaattaagtgccctaatcagattgtgagacagctaaaa
ggattttttgaaactttgtttttgatcatctgtattactgaaacgtcagatgatatggat
gcctcggttgaagatattggcggtcgttcatgtgtcactcgctttgtgagaaccctgtta
ttaattatggaacatggtgtaaaacctcacagtaaacatcttacagagtattttgccttc
ctttacgaatttgcaaaaatgggtgaagaagagagccaatttttgctttcattgcaagct
atatctacaatggtacatttttacatgggaacaaaaggacctgaaaatcctcaagttgaa
gtgttatcagaggaagaaggggaagaagaggaggaggaagaagatatcctctctctggca
gaagaaaaatacaggccagctgcccttgaaaagatgatagctttagttgctcttttggtt
gaacagtctcgatcagaaaggcatttgacattatcacagactgacatggcagcattaaca
ggaggaaagggatttcccttcttgtttcaacatattcgtgatggcatcaatataagacaa
acttgtaatctgattttcagcctgtgtcgatacaataatcgacttgcagaacatattgta
tctatgcttttcacatcaatagcaaagttgactcctgaggcagccaatcctttctttaag
ttgttgactatgctaatggagtttgctggtggacctccagggatgcctccctttgcatct
tatattctgcagaggatatgggaggtgattgaatacaatccttctcagtgtctagattgg
ttggcagtgcagacaccccgaaataaactggcacacagctgggtcctacagaatatggaa
aactgggtcgagcggtttcttttggctcacaattatcctagagtgaggacttctgcagct
tatcttctggtgtcccttataccaagcaattcattccgtcagatgttccggtcaacaagg
tctttgcacatcccaacccgtgaccttccactcagtccagacacaacagtagtcctacat
caggtctacaacgtgctccttggtttgctctcaagagccaaactttatgttgatgctgct
gttcatggcactacaaaactagtgccctattttagctttatgacttactgtttaatttcc
aaaactgagaagctgatgttttccacatatttcatggatttgtggaaccttttccagcct
aaactttctgagccagcaatagctacaaatcacaataaacaggctttgctttcattttgg
tacaatgtctgtgctgactgtccagagaatatccgccttattgttcagaacccagtggta
accaagaacattgccttcaattacatccttgctgaccatgatgatcaggatgtggtgctt
tttaaccgtgggatgctgcctgcctactatggcattctgaggctctgctgtgagcagtct
cctgcattcacacgacaactggcttctcaccagaacatccagtgggcctttaagaatctt
acaccacatgccagccaataccctggagcagtagaagaactatttaacctgatgcagctg
tttatagctcagaggccagatatgagagaagaagaattagaagatattaaacagttcaag
aaaacaaccataagttgttacttacgttgcttagatggccgttcctgctggactacttta
ataagtgccttcagaatactattagaatctgatgaagacagacttcttgttgtatttaat
cgagggttgattctaatgacagagtctttcaacactttgcacatgatgtatcacgaagct
acagcttgccatgtgactggagatttagtagaacttctgtcaatatttctttcggttttg
aagtctacacgcccttatcttcagagaaaagatgtgaaacaagcattaatccagtggcag
gagcgaattgaatttgcccataaactattaactcttcttaattcctatagtcctccagaa
cttagaaatgcctgtatagatgtcctcaaggaacttgtacttttgagtccccatgatttt
cttcatactctggttccctttctacaacacaaccattgtacttaccatcacagtaatata
ccaatgtctcttggaccttatttcccttgtcgagaaaatatcaagctaataggagggaaa
agcaatattcggcctccgcgccctgaactcaatatgtgcctcttgcccacaatggtggaa
accagtaagggcaaagatgacgtttatgatcgtatgctgctagactacttcttttcttat
catcaattcatccatctattatgccgagttgcaatcaactgtgaaaaatttactgaaaca
ttagttaagctgagtgtcctagttgcctatgaaggtttgccacttcatcttgcactgttc
cccaaactttggactgagctatgccagactcagtctgctatgtcaaaaaattgcatcaag
cttttgtgtgaagatcctgttttcgcagaatatattaaatgtatcctaatggatgaaaga
acttttttaaacaacaacattgtctacacgttcatgacacatttccttctaaaggttcaa
agtcaagtgttttctgaagcaaactgtgccaatttgatcagcactcttattacaaacttg
ataagtcagtatcagaacctacagtctgatttctccaaccgagttgaaatttccaaagca
agtgcttctttaaatgggcacatcccccatgtgatcttaatgactttcagagaagtttcc
gttttggcgtatgttttcacagatgatgaaggagcaactcccgttaaaagaaggcgtgtt
agcagtgatgaggagcacactgtagacagctgcatcagtgacatgaaaacagaaaccagg
gaggtcctgaccccaacgagcacttctgacaatgagaccagagactcctcaattattgat
ccaggaactgagcaagatcttccttcccccgaaaatagttctgttaaagaatatcgaatg
gaagttccatcttcgttttcagaagacatgtcaaatatcaggtcacagcacacagaagaa
cagtccagcaatggtagatatgacgattgtaaagaatttaaagacctccactgttccaag
gattctaccctagctgaggaagaatctgagttcccttctacttctatctctgcagttctg
tctgacttagctgacttgagaagctgtgatggccaacctttgccctcccaggaccccgag
gttgctttgtctctcagttgtggccattccagaggactctttagtcatatgcagcaacat
gacattttagataccctgtgtaggaccattgaatctacaatccatgtggtcacaaggata
tctggcaaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system