KEGG   Macaca mulatta (rhesus monkey): 718088Help
Entry
718088            CDS       T01028                                 

Gene name
SPHK2
Definition
sphingosine kinase 2 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    718088 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    718088 (SPHK2)
   04020 Calcium signaling pathway
    718088 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    718088 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    718088 (SPHK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     718088 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 653 aa AA seqDB search
MNGLLEAEEQDQRPEQELTRSWGHRPRSTLVRAKTMAPPPPPLAASTPLLHGEFGSYPAR
GPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTYP
RSRRGSRRRTTRTFRTDGATTYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRPP
RLLLLVNPFGGRGLAWQWCKNYVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDGI
VTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDLL
LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLG
TVLGLATLHTYRGRLSYLPATVEPTSPTPVHSLPRAKSELTLTPDPAPPMAHSPLHRSVS
DLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKTA
LHSPVTEGAPVIPPSSGLPPPTADARVAASTCGLPDHLLPPLGTPLPPDWVTLEGDFVLM
LAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSQFSLGCPQLG
YAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCPGREP
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaatggactccttgaagcagaggagcaggaccagaggccggaacaggagctgaccagg
agctggggccacaggcctaggagcaccctggtcagggctaagaccatggccccgccccca
ccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcccga
ggcccacgctttgccctcaccctcacgtcgcaggccctgcacatacagcggctgcgcccc
aaacccgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgctgc
accctgcgaagccgtagcccctcagactcagcagcctacttctgcatctacacctaccct
cggagccggcgcgggagccggcgcagaaccacccgcaccttccggacagatggggctacc
acctacgaagagaaccgtgccgaggcccagcgctgggccaccgccctcacctgtctgctc
cgaggactgccgctgcccggggatggggagatcacccctgacctgctacctcggccgccc
aggttgctcctattggtcaatccctttggggggcggggcttggcctggcagtggtgtaag
aactacgtgcttcccatgatttctgaagctgggctgtccttcaacctcatccagacagaa
cgacagaaccacgctcgggagctggtccaggggctgagcctgagtgagtgggatggcatc
gtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgccct
gactgggaggaagctgtgaagatgcctgtgggcatcctcccctgtggctcgggcaatgcg
ctggccggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctgctg
ctcaactgctcactgttgctctgccggggtggcggccacccactggacctgctctccgtg
acgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtgtca
gatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactgggc
acggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctccccgcc
actgtggaacccacctcgcccacccctgtccatagcctgccccgtgctaagtcagagctg
accctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtgtct
gacctgcccctgcccctgccccaacctgccctggcctcccctggctcaccagaacccctg
cccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggctggg
gatgctccactgtccccggacccactgctgtcttcacctcctggctctcccaagacagct
ctacactcacccgtcactgagggggcccccgtaattcccccatcttctgggctcccaccg
cccaccgctgatgcccgggtagcggcctccacctgcggcctgcctgaccacctgctgcct
ccgctgggcaccccactgcccccagactgggtgacgctggagggggactttgtgctcatg
ttggccatatcgcccagccacctaggcgctgacctggtggcagctccgcacgcgcgcttc
gacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgttgcta
cgccttttcctggccatggagcgtggtagccagttcagcctgggctgtccgcagctgggc
tacgccgcggcccgtgccttccgcctagagccgctcacgccgcgcggcgtgctcacggtg
gacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcctcggtaca
ctgctcaccgggcctcctggctgcccagggcgggagccctga

DBGET integrated database retrieval system