KEGG   Macaca mulatta (rhesus monkey): 718155Help
Entry
718155            CDS       T01028                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    718155 (MAP2K4)
   04012 ErbB signaling pathway
    718155 (MAP2K4)
   04668 TNF signaling pathway
    718155 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    718155 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    718155 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    718155 (MAP2K4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    718155 (MAP2K4)
  Infectious diseases
   05166 HTLV-I infection
    718155 (MAP2K4)
   05164 Influenza A
    718155 (MAP2K4)
   05161 Hepatitis B
    718155 (MAP2K4)
   05169 Epstein-Barr virus infection
    718155 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    718155 (MAP2K4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     718155 (MAP2K4)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   718155 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 410 aa AA seqDB search
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtagggtccccggcgccgggccacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttg
gatgtagtaatgcggagtagtgattgcccatacatcgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaaactctgtgacttcggc
atcagtggacagcttgtggactctattgccaagacaagagatgctggctgtaggccatac
atggcacctgaaagaatagacccaagcgcatcacgacaaggatatgatgtccgctctgat
gtctggagtttggggatcacattgtatgagttggccacaggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagt
aattctgaggaaagggaattctccccaagtttcatcaactttgtcaacttgtgccttacg
aaggatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatg
tatgaagaacgtgccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system