KEGG   Macaca mulatta (rhesus monkey): 718178Help
Entry
718178            CDS       T01028                                 

Gene name
B3GALT4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 (EC:2.4.1.62)
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    718178 (B3GALT4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    718178 (B3GALT4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     718178 (B3GALT4)
Glycosyltransferases [BR:mcc01003]
 Glycan extension
  Glycolipid
   718178 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 383 aa AA seqDB search
MPLRLFRRLLFTALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACGGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPM
WGSQGNDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWEQWERSTEPQREAEVGNEQQEGGQALHSEEVPLLYLGRVHWRVN
PSRTPGGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPPLPLEDVFVG
VSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTA
PFCSWFQGVLGILRCRAIAWLHS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcaggctcttccggcgcctgctcttcaccgctctgctgctggtgatcgtctgg
accctcttcgggccttcggggttgggggaggagctgctgagcctctcactagcctccctg
ctaccagcccccgcctcaccggggccgcccctggccctgccccgcctcttgatccccaac
caggaagcttgcggtggtcccggggctcctcccttcctgctcatcctggtgtgcacggct
ccggaaaatctgaaccagagaaacgccattcgggcctcgtggggcgggctgcgcgaggcc
cggggactcagggtacagacgctattcctgctgggagagccgaacgcacagcaccccatg
tggggctcccaggggaacgacctggcctcggagtcagcagcccagggggatatcttgcag
gccgccttccaggactcctaccgcaacctcaccctcaagaccctcagtgggctgaactgg
gctgagaaacactgccccatggcccgatacgtcctcaagacggacgatgatgtgtatgtc
aacgtccccgaactggtatcagagctggtcttgcgagggggccgttgggagcaatgggag
agaagcacggaaccccagagagaggctgaggttggaaatgaacagcaggaaggaggccag
gccttgcacagcgaggaagtgcctcttctgtacctgggccgggtgcactggcgagtaaac
ccctctcggacaccagggggcaggcaccgtgtatcagaggagcagtggcctcacacctgg
ggccccttcccaccctatgcctcaggcacggggtatgtgttgtcagcgtctgctgtgcag
cttattctcaaggtggctagccgggcaccccctctcccgttagaggatgtctttgtgggg
gtaagtgcccgaagaggaggcctcgccccaacacagtgtgtcaagctggctggtgccacc
cactacccactagaccggtgctgctatgggaaattcctgctgacgtcccacaggctggac
ccctggaagatgcaggaagcctggaagctggtgggtggctctgacggggaaaggactgcg
cccttttgctcctggttccagggagtcctgggcatcctgcggtgtcgagcaatagcctgg
cttcacagctga

DBGET integrated database retrieval system