KEGG   Macaca mulatta (rhesus monkey): 718361Help
Entry
718361            CDS       T01028                                 

Gene name
LYZ
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:mcc04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 148 aa AA seqDB search
MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESNYNTQA
TNYNPGDQSTDYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVSD
PQGIRAWVAWRNHCQNRDVSQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcattattctggggcttgtcctcctttctgtcacggtccagggcaagatc
tttgaaaggtgtgagttggccagaactctgaaaagattgggactggatggctacagggga
atcagcctagcaaactgggtgtgtttggccaaatgggagagtaattataacacacaagct
acaaactacaatcctggagaccaaagcactgattatgggatatttcagatcaatagccac
tactggtgtaataatggcaaaaccccaggagcagttaatgcctgtcatatatcctgcaat
gctttgctgcaagataacatcgctgatgctgtaacttgtgcaaagagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaaatcactgtcaaaacagagatgtcagt
cagtatgttcaaggttgtggagtgtaa

DBGET integrated database retrieval system