KEGG   Macaca mulatta (rhesus monkey): 718361Help
Entry
718361            CDS       T01028                                 

Gene name
LYZ, LYZF1
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    718361 (LYZ)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     718361 (LYZ)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   718361 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 148 aa AA seqDB search
MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESNYNTQA
TNYNPGDQSTDYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVSD
PQGIRAWVAWRNHCQNRDVSQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcattattctggggcttgtcctcctttctgtcacggtccagggcaagatc
tttgaaaggtgtgagttggccagaactctgaaaagattgggactggatggctacagggga
atcagcctagcaaactgggtgtgtttggccaaatgggagagtaattataacacacaagct
acaaactacaatcctggagaccaaagcactgattatgggatatttcagatcaatagccac
tactggtgtaataatggcaaaaccccaggagcagttaatgcctgtcatatatcctgcaat
gctttgctgcaagataacatcgctgatgctgtaacttgtgcaaagagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaaatcactgtcaaaacagagatgtcagt
cagtatgttcaaggttgtggagtgtaa

DBGET integrated database retrieval system