KEGG   Macaca mulatta (rhesus monkey): 718387Help
Entry
718387            CDS       T01028                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04621  NOD-like receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing's syndrome
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05010  Alzheimer's disease
mcc05016  Huntington's disease
mcc05142  Chagas disease (American trypanosomiasis)
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05200  Pathways in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    718387 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    718387 (PLCB1)
   04310 Wnt signaling pathway
    718387 (PLCB1)
   04371 Apelin signaling pathway
    718387 (PLCB1)
   04020 Calcium signaling pathway
    718387 (PLCB1)
   04070 Phosphatidylinositol signaling system
    718387 (PLCB1)
   04072 Phospholipase D signaling pathway
    718387 (PLCB1)
   04071 Sphingolipid signaling pathway
    718387 (PLCB1)
   04022 cGMP - PKG signaling pathway
    718387 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    718387 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    718387 (PLCB1)
   04621 NOD-like receptor signaling pathway
    718387 (PLCB1)
   04062 Chemokine signaling pathway
    718387 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    718387 (PLCB1)
   04922 Glucagon signaling pathway
    718387 (PLCB1)
   04912 GnRH signaling pathway
    718387 (PLCB1)
   04915 Estrogen signaling pathway
    718387 (PLCB1)
   04921 Oxytocin signaling pathway
    718387 (PLCB1)
   04926 Relaxin signaling pathway
    718387 (PLCB1)
   04918 Thyroid hormone synthesis
    718387 (PLCB1)
   04919 Thyroid hormone signaling pathway
    718387 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    718387 (PLCB1)
   04916 Melanogenesis
    718387 (PLCB1)
   04924 Renin secretion
    718387 (PLCB1)
   04925 Aldosterone synthesis and secretion
    718387 (PLCB1)
   04927 Cortisol synthesis and secretion
    718387 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718387 (PLCB1)
   04270 Vascular smooth muscle contraction
    718387 (PLCB1)
  Digestive system
   04970 Salivary secretion
    718387 (PLCB1)
   04971 Gastric acid secretion
    718387 (PLCB1)
   04972 Pancreatic secretion
    718387 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    718387 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    718387 (PLCB1)
   04725 Cholinergic synapse
    718387 (PLCB1)
   04728 Dopaminergic synapse
    718387 (PLCB1)
   04726 Serotonergic synapse
    718387 (PLCB1)
   04720 Long-term potentiation
    718387 (PLCB1)
   04730 Long-term depression
    718387 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    718387 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718387 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    718387 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    718387 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    718387 (PLCB1)
   05016 Huntington's disease
    718387 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    718387 (PLCB1)
   04934 Cushing's syndrome
    718387 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    718387 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    718387 (PLCB1)
   05143 African trypanosomiasis
    718387 (PLCB1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     718387 (PLCB1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    718387 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    718387 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 718387
NCBI-ProteinID: NP_001244796
Ensembl: ENSMMUG00000004313
UniProt: F6ZKL2
Position
10
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGIKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSFAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMELMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTCSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSETPSEVRTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcatcaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacggtggtgtatgggcctgaccttgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatctt
accgttgaccagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacagcagcttcgccaaaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgcttctgtctggttgtcgctgtgtg
gagctggactgctggaagggacgaactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggagttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagtggcaaaaag
aagctctcagaacaagcctccaacacctgcagcgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgatgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaggaaatg
tctaacctggtgaactacattcagccggtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcgggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacggaaagagtggctatcgattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatatcaggtcagtttctttctgataagaaagtcgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaagacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatatgtctaaggaatgaaagg
aaccagcctctgatgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccggtatgtgaacctgatg
gagcagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagagactccaagtgaagtgagaacaactccagca
gaaaacggggtgaatcacactacatccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtacaatgaaattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaaattgatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaaaaggcaggagaagata
acagaagctaaatctaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtacatcaagaggctagaagaggcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

DBGET integrated database retrieval system