KEGG   Macaca mulatta (rhesus monkey): 718430Help
Entry
718430            CDS       T01028                                 

Definition
dual specificity protein kinase TTK-like
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    718430
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     718430
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: Other group
  TTK family
   718430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 857 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
SPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKTLSASMVLTAQESFSSSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLKQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFIKRQ
TSRSECRDLVVAGSKPSGNDSCELRNLKSVQNINCKEPLVSDEKSSELIITDSVTLKNKT
ESSLRAKLEETKEYQEPEVPESNQKQWQSKRKSACINQNPVASSNQWQIPELARKVNIEQ
KHTTFEQPVFSVSKQSPPMSASKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQQQIPATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKFVNLEEADNQTLDSYRNEIAYLNKLQQHXXXXXXXXXXEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFGKKREKK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
agcccagaggactggttgagtttgttgctcaaactagagaaaaacagtgttcctctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcacttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtggaacgtggagcagtaccactagaaatgctg
gaaattgccctacggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagactttatcagcatctatggtattaactgcccaagaatcattttccagttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactaccaaagccaggttt
ttgtatggagagaacatgcccccacaagatgcagaaataggttatcggaattcattgaaa
caaaccaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagactgtgatgtgaagacagatgattcagttgtaccttgttttataaaaagacaa
acctctagatcagaatgccgagatttggttgtggccggatctaaaccaagtggaaatgat
tcctgtgaattgagaaatttaaagtctgttcaaaatattaattgcaaggaacctctggta
tcagatgaaaagagttctgaacttattattactgattcagtaaccctgaagaataaaact
gaatcaagtcttcgagctaaattagaagaaactaaagagtaccaagaaccagaggttcca
gagagtaaccagaaacagtggcaatctaagagaaagtcagcatgtattaaccagaatcct
gttgcatcttcaaatcagtggcagattccagagttagcccgaaaggttaatatagagcag
aaacacaccacttttgagcaacctgtcttttcagtttcaaaacagtcaccgccaatgtca
gcatctaaatggtttgacccaaaatctatttgtaagacaccaagcagcaataccttggat
gattacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcag
ttgtcaacaccctatggccaacctgcctgtttccagcagcaacagcagcaaatacctgct
actccacttcaaaatttacaggttttagcatcctcttcagcaaatgaatgcatttcggtt
aaaggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtattt
caggtgttgaatgaaaagaaacagatatatgctataaaatttgtgaacttagaagaagca
gataaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaa
cacagnnnnnnnnnnnnnnnnnnnnnnnnnngtgaaatcacggaccagtacatctacatg
gtaatggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgat
ccatgggaacgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaa
catggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgcta
aagctaatcgattttgggatcgcaaaccaaatgcaaccagatacaacaagtattgttaaa
gattctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcc
tccagagagaatgggaagtctaagtcaaagataagccccaaaagtgatgtttggtcctta
ggatgtattttgtactatatgacttatgggaaaacaccatttcagcatataattaatcag
atttctaagttgcatgccataattgatcctaatcatgaaattgaatttcctgatattcca
gagaaagatcttcaggatgtgttaaagtgttgtttaaaaagggacccaaaacagaggata
tccattcctgagctcctggctcatccatacgttcaaattcaaactcatccaggtaaccaa
atggccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaat
tctcctaactccattttgaaagctgctaaaactttatatgaacactatagtggtggtgaa
agtcataattcttcatcatccaagacttttggaaaaaaaagggaaaaaaaatga

DBGET integrated database retrieval system