KEGG   Macaca mulatta (rhesus monkey): 718471Help
Entry
718471            CDS       T01028                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     718471 (USP10)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   718471 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 802 aa AA seqDB search
MPWLPSPGIGRYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQR
IEFGVNEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTTSKTTPDGITKEANYGSIDCQ
YPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEAL
VNGHASSAVPNSVSAEDAEFMGDMPPSVTPRTCNSPQNSTDSVSDTVPDSPFPGALSSDT
RTAGQPEGSPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEG
TATNGVELHTTESIDLDPTKPENASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSP
MAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRG
LINKGNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMP
VPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLH
EEMLNLKKLLSPNNEKLTISNGPKNHSVTEEEQEEQGEGSEDEWEQVGPRNKTSVTRQAD
FVQTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESV
QGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKEL
LSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVISQY
QVVKPTAERTAYLLYYRRVDLL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgccctggttgccctctcctggaatagggcggtatatttttggagattttagccctgat
gaattcaatcagttctttgtgactcctcgatcttcagttgagcttcctccgtacagtgga
acagttctttgtggcacacaggctgtggataaactacctgatggacaagaatatcagaga
attgagtttggtgtcaatgaagtcatcgaacccagtgacactttgccgagaacccccagc
tatagtatttcaagcacactgaaccctcaggcccctgaatttattctcggttgtacaact
tccaaaacaacccctgatggtatcactaaagaagcaaactatggctccatcgactgccag
tacccaggctctgccctcgctttggatggaagttctaatgtggaggcggaagttttggaa
aatgatggtgtctcaggtggtcttggacaaagggagcgtaaaaagaagaaaaagcggcca
cctggatattacagctatttgaaagatggcggtgatgatagtatttccacagaagccctg
gtcaatggccatgccagttcagcagtcccgaacagtgtcagtgcagaggatgcagaattt
atgggtgacatgcccccgtcagttacgcccaggacttgtaacagcccccagaactccaca
gactctgtcagtgacactgtgcctgacagtcctttccccggagcactcagcagtgacacc
aggactgcagggcagccagaggggagccccggggctgattttggtcagtcctgcttccct
gcagaggctggcagagacaccctgtcaaggacagctggggctcagccctgcgttggtacc
gatactactgaaaaccttggagttgctaatggacaaatacttgaatcctcgggtgagggc
acagctaccaatggggtggagttgcacaccacggaaagcatagacttggacccaaccaaa
cccgagaatgcatcacctccggctgacggcacaggctctgcatcaggcacccttcctgtc
agccagcccaagtcctgggccagtctctttcacgattctaagccctcttcctcctcgccg
atggcctatgtggaaactaagtattcccctcccgccatatctcccctggtttctgaaaag
caggttgaagtcaaagaagggcttgttccagtttcagaggatcccgtagccataaagatt
gcagagttactggagaatgtaaccctaatccataaaccagtgtcgttgcaaccccgcggg
ctgatcaataaagggaactggtgctacattaatgctacactgcaggcgctggttgcttgc
ccgccgatgtaccacctgatgaagttcattcctctgtattccaaagtgcaaaggccttgt
acgtcaacacccatgatagacagctttgttcggctaatgaatgagtttactaatatgcca
gtacctccaaaaccccgacaagctcttggagataaaatcgtgagggacattcgcccggga
gctgcctttgagcccacatatatttacagactcctgacagttaacaagtcaagcctgtct
gaaaagggtcgacaagaagatgctgaggaatacttaggcttcattctaaatggacttcat
gaggaaatgttgaacctaaagaagcttctctcaccaaataatgaaaaacttacgatttcc
aatggccccaaaaaccactcagtcactgaagaagagcaggaagaacaaggtgaaggaagc
gaggacgagtgggagcaagtgggcccccggaacaagacttccgtcacccgccaggcggat
tttgttcagactccaatcaccggcatttttggtggacacatcaggtctgtggtttaccag
cagagttcaaaagaatctgccactttgcagccatttttcacgttgcagttggatatccag
tctgacaagatacgcacagtccaggatgccctggagagcttggtggcaagagaatctgtc
caaggttataccacaaaaaccaaacaagaggttgagataagtcgaagagtgactctggaa
aaactccctcctgtcctcgtgctacacctgaaacgattcgtttatgagaagactggtggg
tgccagaagcttatcaaaaatattgaatatcctgtggacttggaaattagtaaagaactg
ctttctccaggggttaaaaataagaattttaaatgccacagaacctatcggctctttgca
gtggtctaccatcacggcaacagtgcgacgggcggccattacactacagacgtcttccag
atcggtctgaatggctggctgcgcatcgatgaccagacagtcaaggtgatcagccagtac
caggtggtgaaaccaactgctgaacgcacagcctacctcctgtattaccgccgagtggac
ctgctctaa

DBGET integrated database retrieval system