KEGG   Macaca mulatta (rhesus monkey): 718524Help
Entry
718524            CDS       T01028                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    718524 (NCOA1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     718524 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1303 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSGSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLTTRPRMPNNSFPPNISTLSSPVGMTSSACNNNTNRSYSNIPVT
SLQGMNEGPNNSVGFSANSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSD
NSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSV
SVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VTSVTIKSEILPASLQSATARPTSRLNSEQLMLRRKILLSHPKHPITGLSEIQYWNPTEF
DFSVICHDRDEVNRKLQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAE
LDRALGIDKLVQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQG
MVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIH
QNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQ
RAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQL
AANPEASLANRNSMVSRGMTGNMGGQFGTGINPQIQQNVFQYPGAGMVPQGEASFAPSLS
PGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNK
NT seq 3912 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaacagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggaaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttacgcttttttc
caacctcagggcagagagccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcggcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacctggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattgacaacaagg
cccagaatgccaaacaattcctttcctcctaatatttcgacattaagctctcctgttggc
atgacaagtagtgcctgtaataataatactaaccgatcttattcaaacatcccagtaaca
tctttacagggtatgaatgaaggacccaataactccgttggcttctctgccaattctcca
gtcctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccattttaaatgaaatgattcaatctgac
aacagctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactt
tcagatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacgaca
actgccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtct
tgcacaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcctct
catagctcactgacagagcggcataaaattctgcaccggctcttacaggagggtagcccc
tcagatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtg
tcagtgactggacaggtacaaggaaactccagtataaaactagagctggatgcttcaaag
aaaaaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagat
ttaagatcaactccaaacctaagcctggatgatgtaaaggtgaaagtggaaaagaaagaa
cagatggatccttgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaata
aaactggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgccc
acgctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcg
gtcaccagcgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgcc
agacccacttccaggctaaatagtgagcagttgatgttaaggagaaaaattttgttgtct
cacccaaaacaccccataacaggactttcagaaatacagtattggaatcctacagaattt
gatttctctgtcatttgtcatgatagagatgaggttaatcgaaagctccagtgtattagc
tcacaattagatgagcttctctgtccacccacaacagtagaagggagaaatgatgagaag
gctcttcttgaacagctggtatccttccttagtggcaaagatgaaactgagctagctgaa
ctagacagagctctgggaattgacaaacttgttcaggggggcggattagatgtattatca
gagagatttccaccacaacaagcaacaccacctttgatgatggaagaaagacccaacctt
tattcccagccttactcttctccttctcctactgccaatctccctagccctttccaaggc
atggtcaggcaaaaaccttcactggggacgatgcctgttcaagtaacacctccccgaggt
gctttttcacctggcatgggcatgcagcccaggcaaactctaaacagacctccggctgca
cctaaccagcttcgacttcaactacaacagcgattacagggacaacagcagttgatacac
caaaatcggcaagctatcttaaaccagtttgcagcaactgctcctgttggcatcaatatg
agatcaggcatgcaacagcaaattacacctcagccacccctgaacgctcaaatgttggca
caacgtcagcgggaattgtacagtcaacagcaccgacagaggcagctaatacagcagcaa
agagccatgcttatgaggcaacaaagctttgggaacaacctccctccctcatctggacta
ccagttcaaatggggaacccccgtcttcctcagggtgctccacagcaattcccctatcca
ccaaactatggtacaaatccaggaaccccacctgcttctaccagcccgttttcacaacta
gcagcaaatcctgaagcatccttggccaaccgcaacagcatggtgagcagaggcatgaca
ggaaacatgggaggacagtttggcactggaatcaatcctcagatacagcagaatgtcttc
cagtatccaggagcaggaatggttccccaaggtgaggccagctttgctccatctctaagc
cctgggagctccatggtgccgatgccaatccctcctcctcagagctctctgctccagcaa
actccgcctgcctccgggtatcagtcaccagacatgaaggcctggcagcaaggagcaata
ggaaacaagtaa

DBGET integrated database retrieval system