KEGG   Macaca mulatta (rhesus monkey): 718524Help
Entry
718524            CDS       T01028                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04915  Estrogen signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05200  Pathways in cancer
mcc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    718524 (NCOA1)
   04919 Thyroid hormone signaling pathway
    718524 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    718524 (NCOA1)
   05224 Breast cancer
    718524 (NCOA1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     718524 (NCOA1)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    718524 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 NCOA_u2 DUF1518 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 718524
NCBI-ProteinID: XP_014967312
Ensembl: ENSMMUG00000020838
UniProt: H9G174
Position
13
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSGSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLTTRPRMPNNSFPPNISTLSSPVGMTSSACNNNTNRSYSNIPVT
SLQGMNEGPNNSVGFSANSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSD
NSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSV
SVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAI
NQNKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLG
TMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQ
FAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQS
FGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLA
NRNSMVSRGMTGNMGGQFGTGINPQIQQNVFQYPGAGMVPQGEASFAPSLSPGSSMVPMP
IPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNVFSQAVQNQSTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaacagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggaaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttacgcttttttc
caacctcagggcagagagccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcggcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacctggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattgacaacaagg
cccagaatgccaaacaattcctttcctcctaatatttcgacattaagctctcctgttggc
atgacaagtagtgcctgtaataataatactaaccgatcttattcaaacatcccagtaaca
tctttacagggtatgaatgaaggacccaataactccgttggcttctctgccaattctcca
gtcctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccattttaaatgaaatgattcaatctgac
aacagctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactt
tcagatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacgaca
actgccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtct
tgcacaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcctct
catagctcactgacagagcggcataaaattctgcaccggctcttacaggagggtagcccc
tcagatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtg
tcagtgactggacaggtacaaggaaactccagtataaaactagagctggatgcttcaaag
aaaaaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagat
ttaagatcaactccaaacctaagcctggatgatgtaaaggtgaaagtggaaaagaaagaa
cagatggatccttgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaata
aaactggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgccc
acgctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcg
gtcaccagcgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgcc
agacccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaa
tttggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctata
aatcagaataaatcagaagaccagtgtattagctcacaattagatgagcttctctgtcca
cccacaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttc
cttagtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaa
cttgttcaggggggcggattagatgtattatcagagagatttccaccacaacaagcaaca
ccacctttgatgatggaagaaagacccaacctttattcccagccttactcttctccttct
cctactgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactgggg
acgatgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcag
cccaggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacaa
cagcgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccag
tttgcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattaca
cctcagccacccctgaacgctcaaatgttggcacaacgtcagcgggaattgtacagtcaa
cagcaccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcaacaaagc
tttgggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtctt
cctcagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacc
ccacctgcttctaccagcccgttttcacaactagcagcaaatcctgaagcatccttggcc
aaccgcaacagcatggtgagcagaggcatgacaggaaacatgggaggacagtttggcact
ggaatcaatcctcagatacagcagaatgtcttccagtatccaggagcaggaatggttccc
caaggtgaggccagctttgctccatctctaagccctgggagctccatggtgccgatgcca
atccctcctcctcagagctctctgctccagcaaactccgcctgcctccgggtatcagtca
ccagacatgaaggcctggcagcaaggagcaataggaaacaatgtgttcagtcaagctgtc
cagaaccagtccacacctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacgaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaacgatcccgca
ctgagacacacaggcctctactgcaaccagctctcatctactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acgtcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system