KEGG   Macaca mulatta (rhesus monkey): 718582Help
Entry
718582            CDS       T01028                                 

Gene name
PTPRR
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, R
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    718582 (PTPRR)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     718582 (PTPRR)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    718582 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 657 aa AA seqDB search
MWRAVGFPALCLLLNLHTAGCFSGNNDHFLAINQKKSGKPVFVYQHSQDIEKSLDIAPQK
IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSVNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSAEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIRATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVAIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCRQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagcagtcggcttccctgcgctgtgcctgctccttaatcttcacactgcaggg
tgcttttcaggaaacaatgatcattttttggcaattaatcagaagaagagtgggaagccg
gtattcgtttatcagcattcacaagacattgagaagagcctggatatcgccccacaaaaa
atctatagacatagctaccattcttcttccgaagctcaagtaagcaaacgccaccagatt
gtcaattcagcatttcctagacctgcatatgacccgtctgtcaatctgctggccatggac
ggtcaagatcttgaagtggaaaatcttccaatcccagcagcaaatgtaattgtggtgaca
ctgcaaatggatgtaaacaaactgaacataaccttgcttcggatcttccgccaaggagtg
gctgcagctttaggactcttaccccagcaagtgcatatcaatcgcctcattggaaagaag
aacagtattgaactgtttgtgtctcccataaaccgaaaaacaggaatttctgatgctctg
ccctctgaggaagttcttcgttcacttaatatcaatgttttgcatcaaagtttatcccag
tttggaattacagaagtctctgctgagaaaaatgttttacaagggcagcatgaagcggac
aaaatctggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttatt
atagtaacgtgtttgatgattctttacagattaaaagagaggtttcagctttccttaaga
caagataaagagaaaaaccaggagatccacctatcacccatcacattacagccagcactg
tctgaggcaaagactgtccacagcatggtccaacctgagcaggccccaaaggtactgaat
gttgtcgtggaccctcaaggccgaggtgctcctgagatcagagctaccaccgctacctcc
gtctgcccttctcctttcaaaatgaagcccataggacttcaggagagacgagggtccaat
gtatctcttacgttggacatgagtagcttggggaacattgaaccctttgtggctataccg
acaccacgggaaaaggtagcaatggagtacctgcagtcagccagccgaattctcacaagg
tctcagctgagggacgtcgtggcaagttcacatttactccaaagtgaattcatggaaata
ccgatgaactttgtggatcccaaagaaattgatattccgcgtcatggaactaaaaatcgc
tataagaccattttgccaaatcccctcagcagagtgtgtttaagaccaaaaaatgtaact
gattcattaagcacctacattaatgctaattatattaggggctacagtggcaaggagaaa
gccttcattgccacgcagggccccatgatcaacactgtggatgatttctggcagatggtt
tggcaggaagacagccctgtgattgttatgatcacaaaactcaaagaaaaaaatgagaag
tgtgtgctatactggccggaaaagagagggatatatgggaaagttgaggttctggttatc
agtgtaaatgaatgtgataactacaccattcgaaaccttgtcttaaagcaaggaagccac
acccaacatgtgaagcattactggtacacctcatggcctgatcacaagactccagacagt
gcccagcccctcctacagctcatgctggatgtggaagaagacagacttgcttcccagggc
cgagggcctgtggttgtccactgcagtgcaggaataggtagaacggggtgttttattgct
acatccattggctgtcgacagttgaaagaagaaggagttgtggatgcactaagcattgtc
tgtcagcttcgtatggatagaggtggaatggtgcaaaccagtgagcagtatgaatttgtg
caccatgctctgtgcctgtatgagagcagactttcagcagagactgttcagtga

DBGET integrated database retrieval system