KEGG   Macaca mulatta (rhesus monkey): 718582Help
Entry
718582            CDS       T01028                                 

Gene name
PTPRR
Definition
protein tyrosine phosphatase, receptor type, R
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mcc04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 545 aa AA seqDB search
MPSFTEQTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINR
KTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSAEKNVLQGQHEADKIWSKEGFYAVV
IFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQP
EQAPKVLNVVVDPQGRGAPEIRATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGN
IEPFVAIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDI
PRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINT
VDDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRN
LVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGI
GRTGCFIATSIGCRQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLS
AETVQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcctagctttacagaacagacactgcaaatggatgtaaacaaactgaacataaccttg
cttcggatcttccgccaaggagtggctgcagctttaggactcttaccccagcaagtgcat
atcaatcgcctcattggaaagaagaacagtattgaactgtttgtgtctcccataaaccga
aaaacaggaatttctgatgctctgccctctgaggaagttcttcgttcacttaatatcaat
gttttgcatcaaagtttatcccagtttggaattacagaagtctctgctgagaaaaatgtt
ttacaagggcagcatgaagcggacaaaatctggagcaaagaaggattttatgctgttgtc
atttttctcagcatctttgttattatagtaacgtgtttgatgattctttacagattaaaa
gagaggtttcagctttccttaagacaagataaagagaaaaaccaggagatccacctatca
cccatcacattacagccagcactgtctgaggcaaagactgtccacagcatggtccaacct
gagcaggccccaaaggtactgaatgttgtcgtggaccctcaaggccgaggtgctcctgag
atcagagctaccaccgctacctccgtctgcccttctcctttcaaaatgaagcccatagga
cttcaggagagacgagggtccaatgtatctcttacgttggacatgagtagcttggggaac
attgaaccctttgtggctataccgacaccacgggaaaaggtagcaatggagtacctgcag
tcagccagccgaattctcacaaggtctcagctgagggacgtcgtggcaagttcacattta
ctccaaagtgaattcatggaaataccgatgaactttgtggatcccaaagaaattgatatt
ccgcgtcatggaactaaaaatcgctataagaccattttgccaaatcccctcagcagagtg
tgtttaagaccaaaaaatgtaactgattcattaagcacctacattaatgctaattatatt
aggggctacagtggcaaggagaaagccttcattgccacgcagggccccatgatcaacact
gtggatgatttctggcagatggtttggcaggaagacagccctgtgattgttatgatcaca
aaactcaaagaaaaaaatgagaagtgtgtgctatactggccggaaaagagagggatatat
gggaaagttgaggttctggttatcagtgtaaatgaatgtgataactacaccattcgaaac
cttgtcttaaagcaaggaagccacacccaacatgtgaagcattactggtacacctcatgg
cctgatcacaagactccagacagtgcccagcccctcctacagctcatgctggatgtggaa
gaagacagacttgcttcccagggccgagggcctgtggttgtccactgcagtgcaggaata
ggtagaacggggtgttttattgctacatccattggctgtcgacagttgaaagaagaagga
gttgtggatgcactaagcattgtctgtcagcttcgtatggatagaggtggaatggtgcaa
accagtgagcagtatgaatttgtgcaccatgctctgtgcctgtatgagagcagactttca
gcagagactgttcagtga

DBGET integrated database retrieval system