KEGG   Macaca mulatta (rhesus monkey): 718632Help
Entry
718632            CDS       T01028                                 

Gene name
PRKACA
Definition
protein kinase, cAMP-dependent, catalytic, alpha
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    718632 (PRKACA)
   04010 MAPK signaling pathway
    718632 (PRKACA)
   04310 Wnt signaling pathway
    718632 (PRKACA)
   04340 Hedgehog signaling pathway
    718632 (PRKACA)
   04020 Calcium signaling pathway
    718632 (PRKACA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    718632 (PRKACA)
   04210 Apoptosis
    718632 (PRKACA)
  Cell communication
   04540 Gap junction
    718632 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    718632 (PRKACA)
   04062 Chemokine signaling pathway
    718632 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    718632 (PRKACA)
   04910 Insulin signaling pathway
    718632 (PRKACA)
   04912 GnRH signaling pathway
    718632 (PRKACA)
   04913 Ovarian Steroidogenesis
    718632 (PRKACA)
   04915 Estrogen signaling pathway
    718632 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    718632 (PRKACA)
   04921 Oxytocin signaling pathway
    718632 (PRKACA)
   04918 Thyroid hormone synthesis
    718632 (PRKACA)
   04919 Thyroid hormone signaling pathway
    718632 (PRKACA)
   04916 Melanogenesis
    718632 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718632 (PRKACA)
   04270 Vascular smooth muscle contraction
    718632 (PRKACA)
  Digestive system
   04970 Salivary secretion
    718632 (PRKACA)
   04971 Gastric acid secretion
    718632 (PRKACA)
   04976 Bile secretion
    718632 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    718632 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    718632 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    718632 (PRKACA)
   04727 GABAergic synapse
    718632 (PRKACA)
   04725 Cholinergic synapse
    718632 (PRKACA)
   04728 Dopaminergic synapse
    718632 (PRKACA)
   04726 Serotonergic synapse
    718632 (PRKACA)
   04720 Long-term potentiation
    718632 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    718632 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    718632 (PRKACA)
   04742 Taste transduction
    718632 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    718632 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    718632 (PRKACA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    718632 (PRKACA)
   05203 Viral carcinogenesis
    718632 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    718632 (PRKACA)
   05020 Prion diseases
    718632 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    718632 (PRKACA)
   05031 Amphetamine addiction
    718632 (PRKACA)
   05032 Morphine addiction
    718632 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    718632 (PRKACA)
  Infectious diseases
   05166 HTLV-I infection
    718632 (PRKACA)
   05169 Epstein-Barr virus infection
    718632 (PRKACA)
   05146 Amoebiasis
    718632 (PRKACA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     718632 (PRKACA)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   718632 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 280 aa AA seqDB search
MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGN
HYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRSGCGDTALEETDPPLLTHPTPWGALLVVRII
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaactccagcgatgtgaaagaattcttagccaaagccaaagaagattttctt
aaaaaatgggaaagtcccgctcagaacacagcccacttggatcagtttgaacgaatcaag
accctcggcacgggctccttcgggcgggtgatgctggtgaaacacaaggagaccgggaac
cactatgccatgaagatcctcgacaaacagaaggtggtgaagctgaaacagatcgaacat
accctgaatgaaaagcgcatcctgcaagccgtcaactttccgttcctcgtcaaactcgag
ttctccttcaaggacaactcaaacttatacatggtcatggaatacgtgcccggtggggag
atgttctcacacctacggcggattggaaggttcagcgagccccatgcccgtttctacgcg
gcccagatcgtcctgaccttcgagtatctgcactcgctggatctcatctacagggacctg
aagccggagaatctgctcattgaccagcagggatacattcaggtgacagacttcggtttc
gccaagcgcgtgaagggccgcacttggaccttgtgcggcacccctgagtatctggcccct
gagattatcctgagcaaaggctacaacaaggctgtggactggtgggccctgggggttctt
atctatgaaatggccgctggctacccgcccttcttcgcagaccagcccatccagatctat
gagaagatcgtctctgggaaggtgaggtccggctgcggggacacagccctggaagaaaca
gaccctcccctgctcactcatcctactccctggggagccctgcttgttgtcagaataatc
tag

DBGET integrated database retrieval system