KEGG   Macaca mulatta (rhesus monkey): 718976Help
Entry
718976            CDS       T01028                                 

Definition
mitogen-activated protein kinase 14-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    718976
   04010 MAPK signaling pathway
    718976
   04370 VEGF signaling pathway
    718976
   04668 TNF signaling pathway
    718976
   04068 FoxO signaling pathway
    718976
 Organismal Systems
  Immune system
   04611 Platelet activation
    718976
   04620 Toll-like receptor signaling pathway
    718976
   04621 NOD-like receptor signaling pathway
    718976
   04622 RIG-I-like receptor signaling pathway
    718976
   04660 T cell receptor signaling pathway
    718976
   04664 Fc epsilon RI signaling pathway
    718976
   04670 Leukocyte transendothelial migration
    718976
  Endocrine system
   04912 GnRH signaling pathway
    718976
   04914 Progesterone-mediated oocyte maturation
    718976
   04917 Prolactin signaling pathway
    718976
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718976
  Nervous system
   04728 Dopaminergic synapse
    718976
   04723 Retrograde endocannabinoid signaling
    718976
   04722 Neurotrophin signaling pathway
    718976
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718976
  Development
   04380 Osteoclast differentiation
    718976
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    718976
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    718976
  Infectious diseases
   05132 Salmonella infection
    718976
   05133 Pertussis
    718976
   05152 Tuberculosis
    718976
   05164 Influenza A
    718976
   05160 Hepatitis C
    718976
   05169 Epstein-Barr virus infection
    718976
   05145 Toxoplasmosis
    718976
   05140 Leishmaniasis
    718976
   05142 Chagas disease (American trypanosomiasis)
    718976
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     718976
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   718976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 311 aa AA seqDB search
AAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEF
NDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKDLKPSNLAVNEDCELKILDF
GLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHI
NQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKML
VLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFV
PPPLDQEEMES
NT seq 937 nt NT seq  +upstreamnt  +downstreamnt
tgccgcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatt
tcagtccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaa
acatgaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaatt
caatgatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatg
tcagaagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaa
ggacctaaaacctagtaatctagctgtgaatgaagactgtgagctgaagattctggattt
tggactggctcggcacacagatgatgaaatgacaggctacgtggccactaggtggtacag
ggctcctgagatcatgctgaactggatgcattacaaccagacagttgatatttggtcagt
gggatgcataatggccgagctgttgactggaagaacattgtttcctggcacagaccatat
taaccagcttcagcagattatgcgtctgacgggaacaccccccgcttatctcattaacag
gatgccaagccatgaggcaagaaactatattcagtctttgacgcagatgccgaagatgaa
ctttgcgaatgtatttattggtgccaatcccctggctgtcgacttgctggagaagatgct
tgtattggactcagataagagaattacagcagcccaagcccttgcacatgcctactttgc
tcagtaccacgatcctgatgatgaaccagtggccgatccttatgatcagtcctttgaaag
cagggacctccttatagatgagtggaaaagcctgacctatgatgaagtcgtcagctttgt
gccaccgcccctcgaccaagaagagatggagtcctga

DBGET integrated database retrieval system