KEGG   Macaca mulatta (rhesus monkey): 718976Help
Entry
718976            CDS       T01028                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05140  Leishmaniasis
mcc05142  Chagas disease (American trypanosomiasis)
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05205  Proteoglycans in cancer
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    718976 (MAPK14)
   04010 MAPK signaling pathway
    718976 (MAPK14)
   04370 VEGF signaling pathway
    718976 (MAPK14)
   04668 TNF signaling pathway
    718976 (MAPK14)
   04068 FoxO signaling pathway
    718976 (MAPK14)
   04071 Sphingolipid signaling pathway
    718976 (MAPK14)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    718976 (MAPK14)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    718976 (MAPK14)
 Organismal Systems
  Immune system
   04611 Platelet activation
    718976 (MAPK14)
   04620 Toll-like receptor signaling pathway
    718976 (MAPK14)
   04621 NOD-like receptor signaling pathway
    718976 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    718976 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    718976 (MAPK14)
   04660 T cell receptor signaling pathway
    718976 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    718976 (MAPK14)
   04659 Th17 cell differentiation
    718976 (MAPK14)
   04657 IL-17 signaling pathway
    718976 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    718976 (MAPK14)
   04670 Leukocyte transendothelial migration
    718976 (MAPK14)
  Endocrine system
   04912 GnRH signaling pathway
    718976 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    718976 (MAPK14)
   04917 Prolactin signaling pathway
    718976 (MAPK14)
   04926 Relaxin signaling pathway
    718976 (MAPK14)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718976 (MAPK14)
  Nervous system
   04728 Dopaminergic synapse
    718976 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    718976 (MAPK14)
   04722 Neurotrophin signaling pathway
    718976 (MAPK14)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718976 (MAPK14)
  Development
   04380 Osteoclast differentiation
    718976 (MAPK14)
  Environmental adaptation
   04714 Thermogenesis
    718976 (MAPK14)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    718976 (MAPK14)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    718976 (MAPK14)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    718976 (MAPK14)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    718976 (MAPK14)
  Infectious diseases
   05132 Salmonella infection
    718976 (MAPK14)
   05133 Pertussis
    718976 (MAPK14)
   05152 Tuberculosis
    718976 (MAPK14)
   05164 Influenza A
    718976 (MAPK14)
   05160 Hepatitis C
    718976 (MAPK14)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    718976 (MAPK14)
   05169 Epstein-Barr virus infection
    718976 (MAPK14)
   05145 Toxoplasmosis
    718976 (MAPK14)
   05140 Leishmaniasis
    718976 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    718976 (MAPK14)
  Drug resistance
   01522 Endocrine resistance
    718976 (MAPK14)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     718976 (MAPK14)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   718976 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 718976
NCBI-ProteinID: XP_014991719
Ensembl: ENSMMUG00000008444
UniProt: G7MRU1
Position
4
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgcc
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgacgcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system