KEGG   Macaca mulatta (rhesus monkey): 719085Help
Entry
719085            CDS       T01028                                 

Definition
mitogen-activated protein kinase 13-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    719085
   04010 MAPK signaling pathway
    719085
   04370 VEGF signaling pathway
    719085
   04668 TNF signaling pathway
    719085
   04068 FoxO signaling pathway
    719085
 Organismal Systems
  Immune system
   04611 Platelet activation
    719085
   04620 Toll-like receptor signaling pathway
    719085
   04621 NOD-like receptor signaling pathway
    719085
   04622 RIG-I-like receptor signaling pathway
    719085
   04660 T cell receptor signaling pathway
    719085
   04664 Fc epsilon RI signaling pathway
    719085
   04670 Leukocyte transendothelial migration
    719085
  Endocrine system
   04912 GnRH signaling pathway
    719085
   04914 Progesterone-mediated oocyte maturation
    719085
   04917 Prolactin signaling pathway
    719085
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    719085
  Nervous system
   04728 Dopaminergic synapse
    719085
   04723 Retrograde endocannabinoid signaling
    719085
   04722 Neurotrophin signaling pathway
    719085
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    719085
  Development
   04380 Osteoclast differentiation
    719085
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    719085
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    719085
  Infectious diseases
   05132 Salmonella infection
    719085
   05133 Pertussis
    719085
   05152 Tuberculosis
    719085
   05164 Influenza A
    719085
   05160 Hepatitis C
    719085
   05169 Epstein-Barr virus infection
    719085
   05145 Toxoplasmosis
    719085
   05140 Leishmaniasis
    719085
   05142 Chagas disease (American trypanosomiasis)
    719085
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     719085
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   719085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 345 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDLWDLGDALWQHQERSRKQ
LWGRGESLKDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHY
NQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQ
SLPQTPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEA
QQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttatgggatttgggggatgcactctggcagcaccaagaaaggagtaggaagcag
ctctggggcagaggggagagcctgaaggacctgaagccaggcaacctagctgtgaacgag
gactgtgaactgaagatcctggattttgggctggcgcggcatgcagatgccgagatgact
ggctacgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgccaggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaagaaggatttcactcagctcttcccgcgggccagcccccag
gctgtggacctgctggagaagatgctggagctagatgtggacaagcgcctgacagccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
caacagccatttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaaactgtag

DBGET integrated database retrieval system