KEGG   Macaca mulatta (rhesus monkey): 719085Help
Entry
719085            CDS       T01028                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Endocrine resistance
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Th1 and Th2 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    719085 (MAPK13)
   04010 MAPK signaling pathway
    719085 (MAPK13)
   04370 VEGF signaling pathway
    719085 (MAPK13)
   04668 TNF signaling pathway
    719085 (MAPK13)
   04068 FoxO signaling pathway
    719085 (MAPK13)
   04071 Sphingolipid signaling pathway
    719085 (MAPK13)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    719085 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    719085 (MAPK13)
   04620 Toll-like receptor signaling pathway
    719085 (MAPK13)
   04621 NOD-like receptor signaling pathway
    719085 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    719085 (MAPK13)
   04660 T cell receptor signaling pathway
    719085 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    719085 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    719085 (MAPK13)
   04670 Leukocyte transendothelial migration
    719085 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    719085 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    719085 (MAPK13)
   04917 Prolactin signaling pathway
    719085 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    719085 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    719085 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    719085 (MAPK13)
   04722 Neurotrophin signaling pathway
    719085 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    719085 (MAPK13)
  Development
   04380 Osteoclast differentiation
    719085 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    719085 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    719085 (MAPK13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    719085 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    719085 (MAPK13)
   05133 Pertussis
    719085 (MAPK13)
   05152 Tuberculosis
    719085 (MAPK13)
   05164 Influenza A
    719085 (MAPK13)
   05160 Hepatitis C
    719085 (MAPK13)
   05169 Epstein-Barr virus infection
    719085 (MAPK13)
   05145 Toxoplasmosis
    719085 (MAPK13)
   05140 Leishmaniasis
    719085 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    719085 (MAPK13)
  Drug resistance
   01522 Endocrine resistance
    719085 (MAPK13)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     719085 (MAPK13)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   719085 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 405 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVWTMPLQDPGVHRADPHCYRQV
HRGPKRGRWLAKLQRDSAIDKRSGDKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENV
IGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSA
GVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTV
DIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ
TPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPF
DDSLEHEKLTVDEWKRKSWGLGLPRLHLQPLFLASSIFMPGLCQP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggattctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgcggtgtgg
actatgcccttgcaagatcccggagttcatcgggcagatcctcactgttacagacaagta
caccgaggccccaagagggggaggtggctcgccaagttgcagagagactcggccatcgac
aagcggtcaggggataaggtggccatcaagaagctgagccggccctttcagtccgagatc
ttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcagcatgagaacgtc
attgggctcctggatgtcttcaccccagcctcctccctgcgcaacttccatgacttctac
ctggtgatgcccttcatgcagacggatctgcagaagatcatggggatggagttcagtgag
gagaagatccagtacctggtgtatcagatgctcaaaggccttaagtacatccactcggct
ggggtcgtgcacagggacctgaagccaggcaacctagctgtgaacgaggactgtgaactg
aagatcctggattttgggctggcgcggcatgcagatgccgagatgactggctacgtggtg
acccgctggtaccgggcccccgaggtgatcctcagctggatgcactacaaccagacagtg
gacatctggtctgtgggctgtatcatggcagagatgctgacagggaaaactctgttcaag
gggaaagattacctggaccagctgacccagatcctgaaagtgaccggggtgccaggcacg
gagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccagtccctgccacag
acccccaagaaggatttcactcagctcttcccgcgggccagcccccaggctgtggacctg
ctggagaagatgctggagctagatgtggacaagcgcctgacagccgcgcaggccctcacc
catcccttctttgaacccttccgggaccctgaggaagagacggaggcccaacagccattt
gatgattccttagaacacgagaaactcacagtggatgaatggaagcgtaagagctggggc
ctcgggcttcctcgcctccacctgcagcctctcttccttgcttcctccatctttatgcct
ggcctctgccagccctag

DBGET integrated database retrieval system