KEGG   Macaca mulatta (rhesus monkey): 719087Help
Entry
719087            CDS       T01028                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    719087 (CLTCL1)
   04142 Lysosome
    719087 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    719087 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    719087 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    719087 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    719087 (CLTCL1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719087 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1640 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKAGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHSMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLAGCQVIHYRTDEYQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAELKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCIYMNRISA
DTIFVTAPHRPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAIRSNLAGA
EKLFARKFSTLFAQGSYAEAAKVAASAPKGILXTRETVQKFQSIPAQPGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSQMLVQDE
EPLADINQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYEGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYHNNLQRYIEIYVQKVNPSRTPAVVGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESRIQEGCKEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDFELIQVCNENSLFKSEARYLVHRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDAPDIASIAVSSALYEEAFAVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCSEPAVWSQLAQAQLQKDLVKEAIDSYIRGDNPSSYLEV
VQAASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRLSELEDFINGPNNAHIQQ
VGDRCYEKGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
VDGQEFHLAQLCGLHIVIHADELEELMCYYQDRGYFEELISMLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLIMMS
YPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTRTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNYLLTEEEDYQGLRASIDAYDNFDNISLAQRLE
KHQLMEFRRIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAASLFTCYDLLHPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDRLDALESLH
KQEEHVMEPAPLMFDFDGHE
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctattcgctttcaagagcacttccagctccaaaaccttggaatt
aatccagccaacattgggttcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagctggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccggcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcattctatggcagaagaggtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagactgcagtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggcgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctcctcataggcatctcggctcagcaaaaccgtgtggttggggca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgccgctgct
tttgcagagctcaagatggaggggaatgccaagcctgccacccttttctgctttgccgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtagatgtgtttttccctccagaggcacagactgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctacatgaaccgtattagtgct
gacacaatatttgtcactgctccacacagaccgacctctggaattattggtgtcaacaaa
aagggacaggtgctgtcagtttgtgttgaggaagataatattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccattcgtagtaacctggctggggca
gagaagttgtttgcgagaaaattcagtaccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcatctgcaccaaagggaatcctgcntaccagagagacggtccagaaa
ttccagagtatacccgctcagcctggccaggcttctccattgctgcagtactttggaatc
ctgctcgaccagggtcagctcaataaacttgaatccctagaactttgccatctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaacgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcaaatgctagtgcaggacgag
gagccactggctgacattaaccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctc
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataagatgtttactcattacgaccgggcccacatcgcccagctctgtgaaaaggca
ggcctcctgcagcaagcgctggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttcttcggctccttgtcggtg
gaggattctgtggagtgtctgcgtgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccatgagcagctgggcacgcaggccctggtggaa
ctctttgaatccttcaagagctatgaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagacgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgcgatcgt
tttggctttgtccatgaccttgtcctgtatttataccacaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtggttggagggctgctt
gatgtggattgttctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgacgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccggattcaggaaggctgcaaggagcctgccactcacaatgcactggct
aaaatctacattgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgtcgcc
tatgagcgggggcagtgtgactttgagctcatccaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtacacagaaaggatccagagctctgggctcacgtcctt
gaggagaccaacccatccaggagacagctaattgaccaggtagtacagacagcattgtca
gaaacacgggatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagtgag
cacaggaatctgcagaatctgctgatcctgactgccatcaaagcagaccgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcaccggacattgcgagcatcgctgtc
agcagcgcgctgtatgaggaggccttcgccgtcttccacaagtttgatatgaatgcttca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcgtatgagtttgcggag
aggtgcagtgagcctgcggtgtggagtcagctggcccaagcccagctccagaaagacttg
gtgaaggaagccatcgactcctatatcagaggggacaacccttcctcttacctggaagtt
gttcaggcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatatttgccttggctaaaacc
agccgtctttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgagaagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
gtggatggacaggagttccacctcgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgcggctactttgaggagctgatc
tcaatgttggaggcggccctgggcctggagcgggcccacatgggcatgttcacagagctg
gccatcctctactccaaattcaagccacagaagatgctggagcacctggagcttttctgg
tcccgtgtcaacatcccaaaggttctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtacgacaatgctgtgcttatcatgatgagc
taccccactgaagcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gttgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacttgctgctggtgctgtcaccccggctggaccacacccggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaactacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcggctggag
aagcatcagctgatggagttcaggcgcattgcagcctatctgtacaagggcaataactgg
tgggcccagagtgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gctgcagagtcgcgagatgctgagctagcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgctttgcagcctctctcttcacctgctatgacctgcttcacccagac
atggtgctcgagctggcttggaggcacaatctcgtggacttggccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacagactggatgccttggagagtctgcac
aagcaagaggagcatgtgatggagccggcccctctcatgtttgattttgatgggcatgaa
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system