KEGG   Macaca mulatta (rhesus monkey): 719248Help
Entry
719248            CDS       T01028                                 

Definition
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2-like
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mcc04014]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mcc04151]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:mcc04062]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:mcc04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:mcc04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mcc04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:mcc04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mcc04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:mcc04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:mcc04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:mcc05032]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 220 aa AA seqDB search
MWGLNTDPDHSWAGPSGENPDEDPEDPPWAPGKDLCHALGDRLKVLLVSASQDGKLIIWD
SYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHT
GYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGA
CDASIKLWDVRDSIFSIKEPIPTLYLVSALAVSLFLNFAA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtggggactcaacactgacccagatcacagctgggctggacccagtggggagaatcca
gatgaggacccggaggaccctccgtgggcacctggcaaagatctatgccatgcactgggg
gaccgactcaaggtgctgctggtcagcgcctcccaggatgggaagctcatcatctgggac
agctacaccaccaacaaggttcacgccatcccgctgcgctcctcctgggtcatgacctgt
gcctatgcgccctcagggaactttgtggcctgtggggggctggacaacatctgctccatc
tacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcctggccacact
gggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagctctggggat
accacctgtgccctgtgggacattgagacaggccagcagacagtgggttttgctggacac
agtggggatgtgatgtccctgtccctggctcccgatggccgcacgtttgtgtcaggcgcc
tgtgatgcttctatcaagctgtgggacgtacgggattccattttttccataaaggagcca
attccaactctgtacctggtctctgcccttgctgtgtccttgtttctgaactttgctgcc
tga

DBGET integrated database retrieval system