KEGG   Macaca mulatta (rhesus monkey): 719248Help
Entry
719248            CDS       T01028                                 

Gene name
GNB2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04371  Apelin signaling pathway
mcc04713  Circadian entrainment
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04926  Relaxin signaling pathway
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    719248 (GNB2)
   04371 Apelin signaling pathway
    719248 (GNB2)
   04151 PI3K-Akt signaling pathway
    719248 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    719248 (GNB2)
  Endocrine system
   04926 Relaxin signaling pathway
    719248 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    719248 (GNB2)
   04727 GABAergic synapse
    719248 (GNB2)
   04725 Cholinergic synapse
    719248 (GNB2)
   04728 Dopaminergic synapse
    719248 (GNB2)
   04726 Serotonergic synapse
    719248 (GNB2)
   04723 Retrograde endocannabinoid signaling
    719248 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    719248 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    719248 (GNB2)
  Substance dependence
   05032 Morphine addiction
    719248 (GNB2)
   05034 Alcoholism
    719248 (GNB2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    719248 (GNB2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719248 (GNB2)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    719248 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 719248
NCBI-ProteinID: XP_014989965
Ensembl: ENSMMUG00000004080
UniProt: H9Z7W5
Position
3
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacccggaggaccctccgtgggcacctggcaaagatctatgcc
atgcactgggggaccgactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atctgggacagctacaccaccaacaaggttcacgccatcccgctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggggggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tctggggataccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagtggggatgtgatgtccctgtccctggctcccgatggccgcacgtttgtg
tcaggcgcctgtgatgcttctatcaagctgtgggacgtacgggattccatgtgccgacag
accttcatcggccacgaatccgacatcaatgcggtggctttcttccccaacggctatgcc
ttcaccaccggctctgatgacgccacgtgccgcctcttcgacctgcgggccgatcaggag
ctcctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcgcgc
agcggccggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggggtcctcgctggccacgacaaccgtgtgagctgccttggggtc
accgacgatggcatggctgtggccactggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system