KEGG   Macaca mulatta (rhesus monkey): 719248Help
Entry
719248            CDS       T01028                                 

Gene name
GNB2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    719248 (GNB2)
   04151 PI3K-Akt signaling pathway
    719248 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    719248 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    719248 (GNB2)
   04727 GABAergic synapse
    719248 (GNB2)
   04725 Cholinergic synapse
    719248 (GNB2)
   04728 Dopaminergic synapse
    719248 (GNB2)
   04726 Serotonergic synapse
    719248 (GNB2)
   04723 Retrograde endocannabinoid signaling
    719248 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    719248 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    719248 (GNB2)
  Substance dependence
   05032 Morphine addiction
    719248 (GNB2)
   05034 Alcoholism
    719248 (GNB2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719248 (GNB2)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    719248 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacccggaggaccctccgtgggcacctggcaaagatctatgcc
atgcactgggggaccgactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atctgggacagctacaccaccaacaaggttcacgccatcccgctgcgctcctcctgggtc
atgacctgtgcctatgcgccctcagggaactttgtggcctgtggggggctggacaacatc
tgctccatctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgctgccgcttcctggatgacaaccaaatcatcaccagc
tctggggataccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagtggggatgtgatgtccctgtccctggctcccgatggccgcacgtttgtg
tcaggcgcctgtgatgcttctatcaagctgtgggacgtacgggattccatgtgccgacag
accttcatcggccacgaatccgacatcaatgcggtggctttcttccccaacggctatgcc
ttcaccaccggctctgatgacgccacgtgccgcctcttcgacctgcgggccgatcaggag
ctcctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcgcgc
agcggccggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggggtcctcgctggccacgacaaccgtgtgagctgccttggggtc
accgacgatggcatggctgtggccactggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system