KEGG   Macaca mulatta (rhesus monkey): 719396Help
Entry
719396            CDS       T01028                                 

Definition
(RefSeq) histone H2B type 1-A
  KO
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    719396
  Immune diseases
   05322 Systemic lupus erythematosus
    719396
  Substance dependence
   05034 Alcoholism
    719396
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    719396
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   719396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 123 aa AA seqDB search
MNMLQLASKGTTTSKKGFKKAVAKTQKKEGKKRKRCCKESYFIYIYKVLKQVHPDTAISS
KAMSMMNSFVSDIFERIAGEASLLAHYDKHSTITSREIQTAMRLLLPGELAKHAVLEGTK
AVT
NT seq 370 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctgcagcttgcttcaaagggcactacaacttccaaaaagggcttcaagaag
gcagtcgctaaaactcaaaagaaggagggtaaaaagcgcaagagatgctgcaaagagagc
tattttatttacatttacaaggtgctgaagcaggtccacccggacactgcaatctcttcc
aaggccatgagtatgatgaattcttttgttagtgacatttttgagcgcattgcaggtgag
gcttccctcctggcgcattatgacaagcactcgaccatcacctccagggagatccagacg
gccatgcgcttgctgctgcccggggaactagccaagcatgctgtgttggagggcaccaag
gctgtcacca

DBGET integrated database retrieval system