KEGG   Macaca mulatta (rhesus monkey): 719609Help
Entry
719609            CDS       T01028                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
  KO
K06989  aspartate dehydrogenase [EC:1.4.1.21]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00760  Nicotinate and nicotinamide metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    719609 (ASPDH)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.21  aspartate dehydrogenase
     719609 (ASPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF108 NAD_binding_3 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 719609
NCBI-ProteinID: XP_002801407
Ensembl: ENSMMUG00000021060
UniProt: A0A1D5QVH6
Position
19
AA seq 283 aa AA seqDB search
MADKGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQKL
AALGERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWNHA
VFVARGALWGTEDITRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSTGPRTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVTGVLVADLSLTDMHVVDVELSGHPGPRGRSF
AVHTHRENPAEPGAVTGSATVTAFWRSLLVCCQLPSRPGIHLC
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagggcccatggagggtgggcgtggtgggctacggccgcctcggacagtcc
ctcgtctcccgcctgttggctcagggaccagaacttggcctagaacttgtttttgtctgg
aatcgtgacccaggacgaatggcagggagcgtgcccccttccctgcagctccagaagctt
gctgcccttggggaaagacaccctgatctggttgtggaagtggcccatcccaaaataatc
catgaatctggggcacaaatcctgcgccatgccaatctcctggtggggtccccctcagct
ctaagtgaccagaccacagagcggcagctcttggaggcctcacagcactggaaccatgcc
gtgtttgtggcccgaggggccctgtggggtaccgaggacatcacgagattggatgcagct
gggggcctccggagccttcgtgtcaccatggccacacaccccgatggcttccggctcgag
ggacccctggctgcagcccacagcaccgggcctcgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgccccccgaaattccaacaccatggcggcggctgccctggct
gcccccagcctgggcttcgatggggtgactggtgtgcttgtggctgatctcagcctcacg
gacatgcacgtggtggatgtagagctgagcggacacccgggccccaggggccgaagcttt
gctgtgcacacccacagagagaaccctgccgagccaggcgcggtaaccggctccgccacc
gtcacggccttctggcggagcctcctggtctgctgccagctcccctccaggccggggatc
catctctgctga

DBGET integrated database retrieval system