KEGG   Macaca mulatta (rhesus monkey): 719609Help
Entry
719609            CDS       T01028                                 

Definition
Josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 188 aa AA seqDB search
MSQGPGAQPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFLATALAQGLCEVLLVVTKEVEE
KGCWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagggcccgggagcacagccgagcccaccctctgtgtaccacgaacggcagcgc
ctggagctatgtgccgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgacgtcaacgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtgctgggactaatcctgaacctgccctcgcccgtgtctctggggctgctgtcactgccg
ctacgccggcggcactgggtggccctgcgccaggtggacggcatctactacaacctggac
tccaagctgcgggcgcccgaggccctgggggacgaggacggagtcagggccttcctggcg
actgcgctggcccagggcctgtgtgaggtgctgctggtggtgaccaaggaggtggaggag
aagggctgctggcttcggacagactga

DBGET integrated database retrieval system