KEGG   Macaca mulatta (rhesus monkey): 719609Help
Entry
719609            CDS       T01028                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     719609 (ASPDH)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C86
   719609 (ASPDH)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    719609 (ASPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 283 aa AA seqDB search
MADKGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQKL
AALGERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWNHA
VFVARGALWGTEDITRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSTGPRTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVTGVLVADLSLTDMHVVDVELSGHPGPRGRSF
AVHTHRENPAEPGAVTGSATVTAFWRSLLVCCQLPSRPGIHLC
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagggcccatggagggtgggcgtggtgggctacggccgcctcggacagtcc
ctcgtctcccgcctgttggctcagggaccagaacttggcctagaacttgtttttgtctgg
aatcgtgacccaggacgaatggcagggagcgtgcccccttccctgcagctccagaagctt
gctgcccttggggaaagacaccctgatctggttgtggaagtggcccatcccaaaataatc
catgaatctggggcacaaatcctgcgccatgccaatctcctggtggggtccccctcagct
ctaagtgaccagaccacagagcggcagctcttggaggcctcacagcactggaaccatgcc
gtgtttgtggcccgaggggccctgtggggtaccgaggacatcacgagattggatgcagct
gggggcctccggagccttcgtgtcaccatggccacacaccccgatggcttccggctcgag
ggacccctggctgcagcccacagcaccgggcctcgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgccccccgaaattccaacaccatggcggcggctgccctggct
gcccccagcctgggcttcgatggggtgactggtgtgcttgtggctgatctcagcctcacg
gacatgcacgtggtggatgtagagctgagcggacacccgggccccaggggccgaagcttt
gctgtgcacacccacagagagaaccctgccgagccaggcgcggtaaccggctccgccacc
gtcacggccttctggcggagcctcctggtctgctgccagctcccctccaggccggggatc
catctctgctga

DBGET integrated database retrieval system