KEGG   Macaca mulatta (rhesus monkey): 719894Help
Entry
719894            CDS       T01028                                 

Gene name
USP21
Definition
ubiquitin specific peptidase 21
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     719894 (USP21)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   719894 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGPPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILGLDLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagcctctgagcaccgcctgggccggacccgagagccacctgttaatatccag
ccccgagtgggatccaagctaccatttgcccccagggcccgcagcaaggagcgcagaaac
ccagcctctgggccaaaccccatgttacgacctctgcctccccggccaggtccccctgat
gaacggctcaagaaactggagctgggacggggacggacctcaggccctcgacccagaggc
ccccttcgagcagatcatggggttcccctgcctggctcaccacccccaactgtggctttg
cctctcccatctcggaccaacttagcccgttccaagtctgtgagcagtggggacttgcgt
ccaatggggattgccttgggagggcaccgtggcaccggagagcttggggctgcactgagc
cgcttggccctccggcctgagccacccactttgagacgtagcacttctctccgccgccta
gggggctttcctggaccccccacactgttcagcatacggacagagccccctgcttcccat
ggctccttccacatgatatccgcccggtcctctgagcctttctactctgatgacaagatg
gctcatcacacactgcttctgggctctggtcatgttggccttcgaaacttgggaaacacg
tgcttcctgaatgctgtgctgcagtgtctgagcagcactcgacctcttcgggacttctgt
cttagaagggacttccggcaagaggtgcctggaggaggccgagcccaagagctcactgaa
gcctttgcagatgtgattggtgccctctggcaccctgactcctgcgaagctgtgaatcct
actcgattccgagctgtcttccagaaatatgttccctccttctctggatacagccagcag
gatgcccaagagttcctgaagctcctcatggagcggctacaccttgaaatcaaccgccga
ggccgccgggctccaccaatccttgccaatggtccagttccctctccaccccgccgagga
ggggctctgctagaagaacctgagttaagtgatgatgaccgagccaacctaatgtggaaa
cgttacctggagcgagaggacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgctgggggcaaagtgtctctgcgggattgtttc
aaccttttcactaaggaagaagagctagagtcggagaatgccccagtgtgtgatcgatgt
cggcagaaaactcgaagtaccaaaaagttgacagtacaaagattccctcgaatcctcggc
ttagatctgaatcgcttttctgcctcccgaggctccatcaagaagagttcagtaggtgta
gactttccactgcagcgactgagcctaggggactttgccagtgacaaagccggaagtcct
gtataccagctgtatgccctttgcaaccactcaggcagcgtccactatggccactacaca
gccctgtgcaggtgccagactggttggcatgtctacaatgactctcgtgtctcccctgtc
agtgaaaaccaggtggcatccagcgagggctacgtgctgttctaccaactgatgcaggag
ccaccccggtgcctgtga

DBGET integrated database retrieval system