KEGG   Macaca mulatta (rhesus monkey): 719910Help
Entry
719910            CDS       T01028                                 

Gene name
PPOX
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    719910 (PPOX)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     719910 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSVLLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGILGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKELPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLAAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgttgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccgtgtccccctaaggtggtcctggtggagggcagtgagcgtctggga
ggctggattcgctctgttcgaggcccgaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccggaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctgcccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccaagccccggggcaaa
gagcctgatgagaccgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgttttcccagtctcttccaagctgagcaaacccatcgttccgtattactgggc
ctgctgctgggggcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgctgcctcaggccctt
gaaacccacctaactagtaggggggtcagtgttctcagaggtcagccagtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgcttagcgagctgctccctgctgaggctgca
cctctggctcgtgccctgagtgccatcactgcggtgtctgtagctgtggtgaatctgcag
taccaaggagcccatctgcctgtccagggatttggacacttggtgccatcttcagaagat
ccaggcatcctgggaatcgtgtatgactcagttgctttccctgagcaggatgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggcgagt
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgccacacaa
ttaggactgaaggagctgccaagtcactgcttggtccatctacacaagaactgcatcccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctggctgctcac
aggttgcccctgactctggctggagcctcctatgagggggttgctgttaatgactgtata
gagagtgggcgccaggcagcagtcagtgtcttgggcacagaacctaacggctga

DBGET integrated database retrieval system