KEGG   Macaca mulatta (rhesus monkey): 719941Help
Entry
719941            CDS       T01028                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    719941
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    719941
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    719941
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 135 aa AA seqDB search
MAGWQSYMDNLMCDGCCQEAAIVGYCHAKYLRAAMAGSIFQSIMPIEIDMIVGKDWEGFF
TNGLTLGAKKCSLIRDSLYVDGDCTMDIRTKSQGHFCIACKASPSMTIFCACPWSLLCVA
PVITLFYNQLLPPED
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacatggataatctgatgtgcgatggctgctgtcaggaggcc
gccattgtcggctactgccatgccaaatacctccgggcagccatggccgggagcatcttt
cagagcattatgccaatagaaatagatatgattgtaggaaaagactgggaaggtttcttt
accaacggtttaactcttggcgcgaagaaatgctcactgatcagagacagtctatatgtc
gatggtgactgcacaatggacatccggacaaagagtcaagggcacttctgcatcgcgtgc
aaagcatctccctcgatgactattttctgtgcttgcccctggagtcttctctgtgttgca
cctgtgatcacactgttctataaccagcttcttcccccagaggactga

  All links  
No link information was found.   
DBGET integrated database retrieval system