KEGG   Macaca mulatta (rhesus monkey): 719968Help
Entry
719968            CDS       T01028                                 

Gene name
XIAP, BIRC4
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    719968 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    719968 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    719968 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    719968 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    719968 (XIAP)
   05222 Small cell lung cancer
    719968 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    719968 (XIAP)
   05145 Toxoplasmosis
    719968 (XIAP)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    719968 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 301 aa AA seqDB search
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFADFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENSATQSTNSGIQNGQYKVENY
LGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGKLYYKTN
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaa
gaagaatttgtagaagagtttaatagattaaaaacttttgcagattttccaagtagtagt
cctgtttcagcatcaacactggcacgagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagctgtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatctccaaattgcagatttatcaatggcttttattttgaaaat
agtgccacgcagtctacaaattctggtatccagaatggtcagtacaaagtcgaaaactat
ctgggaagcagaaatcattttgccttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccctgccatg
tatagtgaagaagctagattaaagtcctttcagaactggccagactatgctcacctaacc
ccaagagagttagcaagtgctggactctactacacaggtattggtgaccaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatcttaatattcgaagtgaa
tctgatgctgtgagttctgataggaatttcccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatcattacttttgggacatggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtaaactttattataaaaccaat
aaatag

DBGET integrated database retrieval system