KEGG   Macaca mulatta (rhesus monkey): 719987Help
Entry
719987            CDS       T01028                                 

Definition
glucose-6-phosphatase 2-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    719987
   00052 Galactose metabolism
    719987
   00500 Starch and sucrose metabolism
    719987
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    719987
   04151 PI3K-Akt signaling pathway
    719987
   04152 AMPK signaling pathway
    719987
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    719987
   04920 Adipocytokine signaling pathway
    719987
  Digestive system
   04973 Carbohydrate digestion and absorption
    719987
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     719987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 225 aa AA seqDB search
VIQFLCFLHLYLFFHRRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVIPGVIGGMLVA
EAFEHTPGIQMASLGTYLKTNLFLFLFALGFYLLLRLLNIDLLWSVPIAKKWCANPDWIH
VDTTPFAGLVRNLGVLFGLGFAVNSEMFLLSCRGGYSYTLSFRLLCALTSLTTLHLYHFL
QIPTQEEHLFYVLSFCKSASIPLTLVTFIPYYVHMLMKQNGKKIQ
NT seq 680 nt NT seq  +upstreamnt  +downstreamnt
gagtgatacagtttctttgctttttacacttgtatctattcttccatcgcagactgacct
ggtcatttctttggagtgttttttggttgattcaaatcagtgtctgcatctccagagtat
tcatagcaacacattttcctcatcaagttattcctggagtaattggtggcatgctggtgg
cagaggcctttgaacacactccaggcatccaaatggctagcctgggcacatacctaaaga
ccaatctcttcctcttcctgtttgcacttggtttttacctgcttcttagactgctcaaca
ttgacctactgtggtccgtgcccatagccaaaaagtggtgtgccaaccccgactggatcc
acgttgacaccacgccttttgctggactcgtgagaaacctcggggtcctcttcggcttgg
gctttgcagtcaactcggagatgttcctcctgagctgccgaggtggatatagctacacac
tgagcttccggttgctctgtgccttgacctcattgaccacattgcacctctaccatttcc
tccagatcccgactcaggaagagcatttattttatgtgctgtctttttgtaaaagtgcat
ccattcccctaactttggttactttcattccctactatgttcatatgttaatgaaacaaa
acggaaagaagattcagtag

DBGET integrated database retrieval system