KEGG   Macaca mulatta (rhesus monkey): 719996Help
Entry
719996            CDS       T01028                                 

Gene name
FCGR2A, CD32
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Phagosome
Osteoclast differentiation
Platelet activation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    719996 (FCGR2A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    719996 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    719996 (FCGR2A)
  Development
   04380 Osteoclast differentiation
    719996 (FCGR2A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    719996 (FCGR2A)
  Infectious diseases
   05150 Staphylococcus aureus infection
    719996 (FCGR2A)
   05152 Tuberculosis
    719996 (FCGR2A)
   05140 Leishmaniasis
    719996 (FCGR2A)
Cellular antigens [BR:mcc04090]
 Proteins
  719996 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 315 aa AA seqDB search
MTMETQMSQNVCPSNLWLLQPLTVLLLLASADSQTAPPKAVLKLEPPWINVLREDSVTLT
CGGAHSPDSDSTQWFHNGNLIPTHTQPSYMFKANNNDSGEYRCQTGRTSLSDPVHLTVLS
EWLALQTTHLEFREGETIMLRCHSWKDKPLIKVAFFQNGKSKNFSHMNPNFSIPQANHSH
SGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSPMGIIVAVVTGIAVVAIVAAVVALIYC
RKKRISANSTDPVKAARNEPLGRQTIALRKRQLEETNNDYETADGGYMTLNPRAPTDDRN
IYMTLSPNDYDNSNN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagcaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaaactgctcccccgaaggct
gtgctgaaactcgagcccccgtggatcaacgtgctccgggaggactctgtgactctgacg
tgtgggggcgctcacagccctgacagcgactccacccagtggttccacaatgggaatctc
atccccacccacacgcagcccagctacatgttcaaggccaacaacaatgatagcggggag
tacaggtgccagactggccggaccagcctcagcgaccctgttcatctgactgtgctttct
gagtggctggcgcttcagaccactcacctggagttccgggagggagaaaccatcatgctg
aggtgccacagctggaaggacaagcctctgatcaaggtcgcattcttccagaatggaaaa
tccaagaacttttcccatatgaatcccaacttctccatcccacaagcaaaccacagtcac
agtggtgattaccactgcacaggaaacataggctacacgccatactcatccaaacctgtg
accatcactgtccaagtgcccagcgtgggcagctcttcaccgatggggatcattgtggct
gtggtcactgggattgctgtagtggccattgttgctgctgtagtggccttgatctactgc
aggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccgaaatgagcca
cttggacgtcaaacgattgccctcagaaagagacaacttgaagaaaccaacaatgactat
gaaacagccgacggcggctacatgactctgaaccccagggcacctactgatgatagaaac
atctacatgactctttctcccaacgactatgacaacagtaataactaa

DBGET integrated database retrieval system