KEGG   Macaca mulatta (rhesus monkey): 720286Help
Entry
720286            CDS       T01028                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    720286 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    720286 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    720286 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    720286 (COMP)
 Human Diseases
  Infectious diseases
   05144 Malaria
    720286 (COMP)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   720286 (COMP)
  Exosomal proteins of colorectal cancer cells
   720286 (COMP)
  Exosomal proteins of bladder cancer cells
   720286 (COMP)
Cell adhesion molecules and their ligands [BR:mcc04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     720286 (COMP)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     720286 (COMP)
   VNR
     720286 (COMP)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   720286 (COMP)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   720286 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 684 aa AA seqDB search
MQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNA
HPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTDINECETGQHNCVP
NSVCINTRGSFQCGPCQPGFVGDQESGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSC
VCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACD
PDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRTQKNDDQKDTDQDGRGDACDD
DIDGDRIRNQADNCPRIPNSDQKDSDGDGIGDACDNCPQKSNPDQGDVDHDFVGDACDSD
QDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDNDDDNDGVPDSRDNCRLVPNPGQE
DADRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVV
LNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVM
WKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTDSQVRLLWKDPRN
VGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENII
WANLRYRCNDTIPEDYETHQLRRA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtcagtgcgcaccggcctacccagcgtgcggcccctgctccactgcgcgccc
ggcttctgcttccctggcgtggcctgcatccagacggagagcggcgcgcgctgcggcccc
tgccccgcgggcttcacgggcaacggctcgcactgcaccgacgtcaacgagtgcaacgcc
cacccctgcttcccgcgagtccgctgtatcaacaccagcccggggttccgctgcgaggct
tgcccgccggggtacagcggccccacccacgagggcgtggggctggctttcgccaaggcc
aacaagcaggtttgcacggacatcaacgagtgtgagaccgggcaacataactgcgtcccc
aactccgtgtgcatcaacacccggggttccttccagtgcggcccgtgtcagcccggcttc
gtgggcgaccaggagtccggctgccagcggcgcgcacagcgcttctgccccgacggctcg
cccagcgagtgccacgagcatgcggactgcgttctggagcgcgatggctcgcggtcgtgc
gtgtgtgccgtcggctgggcaggcaacgggatcctctgtggccgcgacactgacctagac
ggcttcccggacgagaagttgcgttgcccagagcgccagtgccgtaaggacaactgcgta
actgtgcccaactcagggcaggaggatgtggaccgcgatggcatcggagacgcctgcgac
ccggatgccgacggggatggggtccccaatgaaaaggacaactgcccgctggtgcggaac
ccagaccagcgcaacacggacgaggacaagtggggcgatgcgtgcgacaactgccggacc
cagaagaacgacgaccaaaaggacacagaccaggacggccggggcgatgcgtgcgacgac
gacatcgacggcgaccggatccgcaaccaggccgacaactgccccaggatacccaactca
gaccagaaggacagtgatggcgatggtataggggatgcctgtgacaactgtccccagaag
agcaacccggatcagggggatgtggaccacgactttgtgggagatgcttgtgacagcgat
caagaccaggacggagatggacatcaggactctcgggacaactgtcccacggtgcctaac
agtgcccagcaggactcagaccacgacggccagggtgatgcctgcgacaacgacgacgac
aatgacggagtccctgacagtcgggacaactgccggctggtgcccaaccctggccaggag
gacgcagacagggacggcgtgggcgacgtgtgccagggcgactttgatgcagacaaggtg
gtagacaagatcgacgtgtgtccggagaacgctgaagtcaccctcaccgacttccgggcc
ttccagacagtcgtgctggacccggagggtgacgcgcagattgaccccaactgggtggtg
ctcaaccagggaagggagatcgtgcagacaatgaacagcgacccaggcctggctgtgggt
tacactgccttcaatggcgtagacttcgagggcacgttccatgtgaacacggtcacggat
gacgactatgcgggtttcatctttggctaccaagacagctccagcttctacgtggtcatg
tggaagcagatggagcaaacgtactggcaggcgaaccccttccgtgcggtggccgaaccc
ggcatccaactcaaggctgtgaaatcttccacgggccctggggaacagctgcggaacgca
ctgtggcatacaggagacacagactcccaggtgcggctgctgtggaaggacccgcgaaat
gtgggttggaaggacaagaagtcctatcgttggttcctgcagcaccggccccaagtgggc
tacatcagggtgcgattctatgagggtcctgagctggtggccgacagcaacgtggtcttg
gacacaaccatgcggggtggccgcctgggggtcttctgtttctcccaggagaacatcatc
tgggccaacctgcgttaccgctgcaatgacaccattccagaggactatgagacccatcag
ctgcggcgagcctag

DBGET integrated database retrieval system