KEGG   Macaca mulatta (rhesus monkey): 720615Help
Entry
720615            CDS       T01028                                 

Gene name
PGAM2
Definition
phosphoglycerate mutase 2 (muscle)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    720615 (PGAM2)
   01230 Biosynthesis of amino acids
    720615 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    720615 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    720615 (PGAM2)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     720615 (PGAM2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   720615 (PGAM2)
  Exosomal proteins of melanoma cells
   720615 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 240 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEARRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMNEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGETPSEAWAGWVGSSPSWLLISAKPLAHGPGRFLGVGLHIVH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgccttgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaagggggccgaggaggccaggcgg
ggagccaaggccatcaaggacgccaagatggagtttgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctgggccatcctggatggcacggaccagatgtggctgcct
gtggtgcgcacttggcgcctcaacgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctcctttgac
atcccgccgccccccatgaacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactgcccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgcttattgcagctcacgggaacagcctgcggggcattgtcaagcacctggaaggtgag
acgccctcagaagcctgggcagggtgggtgggcagcagccccagctggcttctcatctca
gcaaagcctctagcccatggaccaggccgctttctaggcgtggggctccacatcgttcac
tga

DBGET integrated database retrieval system