KEGG   Macaca mulatta (rhesus monkey): 720615Help
Entry
720615            CDS       T01028                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2 (muscle)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    720615 (PGAM2)
   01230 Biosynthesis of amino acids
    720615 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    720615 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    720615 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    720615 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    720615 (PGAM2)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     720615 (PGAM2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   720615 (PGAM2)
  Exosomal proteins of melanoma cells
   720615 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 240 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEARRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMNEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGETPSEAWAGWVGSSPSWLLISAKPLAHGPGRFLGVGLHIVH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgccttgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaagggggccgaggaggccaggcgg
ggagccaaggccatcaaggacgccaagatggagtttgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctgggccatcctggatggcacggaccagatgtggctgcct
gtggtgcgcacttggcgcctcaacgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctcctttgac
atcccgccgccccccatgaacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactgcccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgcttattgcagctcacgggaacagcctgcggggcattgtcaagcacctggaaggtgag
acgccctcagaagcctgggcagggtgggtgggcagcagccccagctggcttctcatctca
gcaaagcctctagcccatggaccaggccgctttctaggcgtggggctccacatcgttcac
tga

DBGET integrated database retrieval system