KEGG   Macaca mulatta (rhesus monkey): 721412Help
Entry
721412            CDS       T01028                                 

Definition
beta,beta-carotene 15,15'-monooxygenase-like
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    721412
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     721412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 97 aa AA seqDB search
EIYYRSKYLRSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFTYLSHTIPDFTDNCL
INIMKCGEDFYATSETNYIRKINPQTLETLEKVSTHK
NT seq 296 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatctattacaggagcaaatacctgagaagcgatacctacaacgccaatattgagg
caaacaggattgtggtgtctgagtttggaacaatggcctatccggacccctgcaaaaaca
tattttccaaagctttcacctacttgtctcacaccatccccgatttcacagacaactgcc
tgatcaacatcatgaagtgcggagaagacttctatgcgacctcagagaccaattacatca
ggaaaatcaacccacagactctggaaaccctggagaaggtatcaacacataagtaa

DBGET integrated database retrieval system