KEGG   Macaca mulatta (rhesus monkey): 721508Help
Entry
721508            CDS       T01028                                 

Gene name
PNPLA7
Definition
(RefSeq) patatin like phospholipase domain containing 7
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    721508 (PNPLA7)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     721508 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 1342 aa AA seqDB search
MEEEKDDSPQAGFCLGTALHSWGLWFTEEGSPSTMLTGIAVGALLALALAGVLILFTFRR
LSQFRQAQPTPQYRFRKRDKVMFYGRKIMRKVTTLPNTLVENAALPRQRARKRTKVLSLA
KRILRFKKEYPALQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCRHIVFVRLQEGEHVFRPGAPDPSICVVQDGRLEVCIQDADGTEVVVKEVLAGDSVHS
LLSILDIITGHTAPYKTVSARAAVPSTILRLPAAAFHGVFEKYPETLVRVVQIIMLRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCD
SDHGGGRPAAAGPLLKRSQSVPAPSVRKEILDELEKPGAGDADPSAPQGGPASATSDLGM
ACDRARVFLHSDEYPGSSMASKSKKNVMVAEMPSPVSHHSESHADETLASRKSDAIFRAA
KKDLLTLMKLEDSSLLDGRVVLLHVPAGTVVSRQGDQDASILFVVSGLLHVYQRKIGSQE
DTCLFLTRPGEMVGQLAVLTGEPLIFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRMSSFVRQIDFALDWVEVEAGRAIYRQGDKSDCTYIMLSGRLRSVIRKDDGKKRLA
GEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGPVTGHQLGLPTAGSKWDSGNPAVNLSTVAVMPVSEEVPLTAFALELEHALS
AIGPTLLLTSDNIKRRLGSAALDSVHEYRLSSWLGQQEDTHRIVLYQADGTLTPWTQRCV
RQADCILIVGLGDQEPTVGELERMLESTAVRAQKQLILLHREEGPAPARTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPKLVEMYKRVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGVLKALAECGIPVDMVGGTSIGAFMGALYSEERNYSQMRIRAKQWAEGMTSMMK
AALDLTYPITSMFSGAGFNSSICSVFKDRQIEDLWIPYFAITTDITASAMRVHTDGSLWR
YVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLT
NYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEVVKSSDYCEYLRPPI
DSYGTLDFSKFNEICEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKRPSSEVLTCPNAS
FTDLAEIVSCIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAERGSDSEDESL
LQHGHPSLAFPKLSEGSSDQDG
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagaaagatgacagcccacaggctggcttctgcctgggcaccgctctgcac
tcttgggggctgtggttcacggaggaaggttcaccgtccaccatgctgacggggattgcg
gttggagccctcctggccctggccttggctggtgttctcatccttttcacgttcagaagg
cttagccaatttcgacaagcgcagcccactcctcagtaccggttccgaaagagagacaaa
gtgatgttttacggccggaagatcatgaggaaggtgaccacgctccccaacacccttgtg
gagaacgccgcactgccccggcagcgggccaggaagaggaccaaggtgctatctttggcc
aagaggattctgcgtttcaagaaggaatacccggccctgcagcccaaggagcccccgccc
tccctgctggaggccgacctcacggagtttgacgtgaagaattctcacctaccatcggaa
gttctgtacatgctgaaaaatgttcgggtcctgggccacttcgagaagccgctgttcctg
gagctttgcagacacatcgtctttgtacggctgcaggagggggagcacgtcttccggccc
ggggcgccagaccccagcatctgtgtggtgcaggacgggcggctggaggtctgcatccag
gacgctgacggcaccgaggtggtggtgaaagaggttctggccggagacagcgtccacagc
ctgctcagcatcctggacatcatcaccggccacactgcaccttacaaaacggtctccgcc
cgcgcggccgtcccgtccaccatcctccggcttccagctgcggcttttcacggagttttt
gaaaaatatccagaaactctggtgagggtggtgcagatcatcatgctgcggctgcagaga
gtgaccttcctggctctgcacaactacctcggcctgaccacagagctcttcaaccctgag
agccaggccatccctctcgtgtctgtagccagcgtggctgctgggaaggccaagaaacag
gtgttctatggtgaagaagagcggcttaaaaagccaccgcggctccaggagtcttgtgac
tcagatcacgggggcggccgcccagcagctgctgggcctctgctgaagaggagccagtcc
gttcccgcgccttctgttcgcaaagagatcttggacgagctggagaagcctggggcaggt
gatgctgacccttcagccccacaagggggcccagccagtgccacttccgatctggggatg
gcatgtgaccgtgccagggtcttcctgcactcggacgagtaccctgggagctccatggcc
agcaagtccaagaaaaacgtgatggtcgcagagatgccctccccagtctcccaccactca
gagagtcatgcggatgagaccctggccagcaggaagtcggacgccatcttcagagctgcc
aagaaggacctgctcaccctgatgaagctggaagactcatctctgttggatggccgggtg
gtgcttctccacgttcctgcaggcacggtggtgtcaaggcagggagaccaggacgccagc
atcctgttcgtggtctccgggctgctgcacgtgtaccagaggaagatcggcagccaggag
gacacctgcctgttcctcacgcgccccggggagatggtgggccagctggcggtgctcact
ggggagccgctcatcttcaccatcaaggccaacagggactgcagcttcctgtccatctcc
aaggcccacttctatgaaatcatgcggaagcagccgaccgtcgtcctgggcgtggcgcac
accgtggtgaagaggatgtcgtccttcgtgcggcaaatcgactttgccctggactgggtg
gaggtggaggccgggcgagcgatatacaggcagggggacaagtctgactgcacgtacatc
atgctcagcggccggctgcgctctgtgatccggaaggacgacgggaagaagcgcctggcc
ggggagtacggccgaggagaccttgtcggtgtggtggagacgctgacccaccaggcccgg
gcgaccacggtgcatgccgttcgggactcagaactggccaagctgccggcaggagccctc
acgtccatcaagcgcaggtacccacaggtggtgactcggctgattcatctcttgggtgag
aagatcctgggtagcctccagcagggacctgtgacaggccaccagcttgggctccccacg
gcaggcagcaagtgggactcggggaacccggctgtcaacctgtccacggtggcagtgatg
cccgtgtcagaggaagtgcccctcaccgccttcgccctggagctggagcacgccctcagc
gccattggcccgaccctgctgctgaccagtgacaacataaaacggcgcctcggctccgct
gccctggacagtgtccacgagtaccggctgtccagctggctggggcagcaggaggacacg
cacaggatcgtgctctaccaggcagacggcacgctcacaccctggacccagcgctgcgtg
cgccaggccgactgcatcctcatcgtgggcctgggtgaccaggagcccacagtgggcgag
ctggagcggatgctggagagcacagctgtgcgtgctcagaagcagctgatcctgctgcac
cgggaggagggcccggcgcccgcccgcaccgtggagtggctgaacatgcggagctggtgc
tctggccacctgcacctctgctgcccacgccgcgtcttctccaggaggagcctgcccaag
ttggtggagatgtacaagcgcgtcttccagcggcccccggaccgacactcagacttctcc
cgcttggcgagggtgctgacgggcaacgccattgccctggtgcttgggggagggggagca
agaggctgtgcccaggtgggcgttctcaaggccttggcggagtgcggcatccccgtggat
atggtgggaggcacatccatcggggccttcatgggtgccctgtactctgaggagcggaac
tacagccagatgcggatccgggccaagcagtgggctgagggcatgacgtccatgatgaag
gccgcactggacctcacctaccccatcacatccatgttctctggagccggcttcaacagc
agcatctgcagcgtcttcaaggaccggcagatcgaggacctgtggattccctatttcgcc
atcaccactgacatcacagcctcggccatgcgggtccacaccgatggctccctgtggcgg
tatgtgcgtgccagcatgtccctgtccggttacatgccccctctctgtgaccccaaggac
ggacacctgctgatggatgggggctacatcaacaacctcccagcggatgtggcccggtcc
atgggggcaaaagtggtgattgccattgatgtgggcagccgagatgagacggacctcacc
aactatggggatgcgctgtctggctggtggctgctgtggaaacgctggaaccccttggcc
acgaaagtcaaggtgttgaacatggcggagattcagacgcgcctggcctacgtgtgctgc
gtgcggcagctggaggtggtgaagagcagtgactactgcgagtacctgcgcccccctatc
gacagctacggcaccctggacttcagcaagttcaacgagatctgcgaagtggggtaccag
cacgggcgcacggtgtttgacatctggggccgcagtggcgtgctggagaagatgctgcgc
gaccagcagggcccaagcaagaggccctcgagtgaggtcctcacctgtcccaacgcctcc
ttcacggaccttgctgaaattgtgtcttgcattgagcccgccaagcccgccatggtggat
gacgaatctgattaccagacggagtatgaggaggagctgctggacgtccccagggatgca
tacgcagacttccagagtacctcggcggagcggggctcggactcggaggacgagtccttg
ctgcagcatggacaccccagcctggctttcccaaaactgtccgagggctcctctgaccag
gatgggtag

DBGET integrated database retrieval system