KEGG   Macaca mulatta (rhesus monkey): 721617Help
Entry
721617            CDS       T01028                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    721617 (ENTPD2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     721617 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 795 aa AA seqDB search
MGSPGLPPTGPRTKPLTPFWLLVLTWAGTLLSPHRKGTALARLHFRQRPAEGAGRLRRGS
KGSFPPQPGHQDKVAVAWTEADGGGGDGLTGPSQPSVSVQLPSYPEDGSGLSRGHKDARP
GSPGQERERILRACAPQPQHQVDCSTVGGPVAAGEKPPPSAGWGLPTRASPRLPLRVPAM
PWGILASLEGWKQETEQCLSRDDFIRRPPTELDPAAKAEMSPQKAGDVPVADPHPKPGLG
TLFLVFQAVLGVTWAVSALPRPCVLTFTSAGGSSLAGRASRRPAWSSPALGVGVRALLHK
QVLTLGFLLSPQPGARVAPQPTGVRAPRHTRLTPFPSPQYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGAGQSLVGCLEQALRDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLRLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHSFHPCWPRGFSTHVLLGDVYQSPCTVAQRPQTFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFIAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQQAHLADYCAGAMFVQQLLSRGYGFDERAF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALV
LLLHQVHSAKLPSTI
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgggctccccaggcctgcctccgactggcccccgcaccaagcccttgactccgttttgg
ctcctggtactgacatgggctgggactctcttgagtccgcataggaaaggcactgctctc
gccaggctgcacttccgacaacggccagcagagggcgcggggcggctccgacgcgggtcc
aagggcagcttcccccctcaaccagggcaccaggacaaggtggctgtagcttggacggaa
gcagatggagggggtggggatggcctgacaggcccaagccagcccagcgtcagcgtgcag
ctgccctcctaccctgaggatgggagtgggctttccaggggacataaggatgccaggcct
ggatctcctgggcaggaaagggagcggatcctgagggcctgtgccccacagccccagcac
caggtggactgcagcacagtgggtgggccagtggcagccggggagaagccccccccgtca
gcaggctggggtctgcccaccagggcctccccacgtctgcctttgagggtgcctgccatg
ccctgggggatcctggcatctttagagggctggaagcaggagacagaacagtgtctgtcc
cgggatgacttcatcaggagaccgcccacagagctggaccccgcagctaaagcggaaatg
tctccccagaaggctggggacgtccccgttgctgacccgcaccccaaacctggcctgggg
accctcttccttgtctttcaggccgtgctcggtgtgacctgggccgtctctgcccttccc
cgcccctgcgtcctcaccttcacctcagctggcggatcctcgctggccgggagggcatcc
cgcaggccagcctggtcctcaccagccctgggagttggcgtcagggccttgctccacaag
caggtgctgaccctcggcttcctcctgagtccccagcccggggcccgcgtggctccgcag
ccgacaggtgtcagggcccccagacacaccaggctgactcccttcccctccccccagtac
ggcattgtcctggacgctggctcttcacacacgtccatgtttatctacaagtggccggca
gacaaggagaacgacacaggcatcgtgggccagcacagctcctgtgatgttccaggcggg
ggcatctccagctacgcagacaacccttctggggccggccagagtcttgttggatgcctt
gaacaggcgcttcgggatgtgcccaaagagagacacgcgggcacgcccctctacctggga
gccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctcaaccagtgtgctc
acggcagtgacgcacacactgacccagtacccctttgacttccggggtgcacgcatcctc
tcgggccaggaagagggggtgtttggctgggtgactgccaactacctgctcgagaacttc
atcaagtacggctgggtgggccggtggttccggccacggaaggggacgctgggggccatg
gacctggggggtgcctccacccagatcacctttgagacgaccagtccggctgaggacaga
gccagtgaggtccagctgcgtctctacggccagcattaccgagtctacacccacagcttc
ctctgctacggccgtgaccaggtcctccagcggctgctggccagcgctctccagacccac
agcttccacccctgctggccaaggggcttttccacccacgtgctgctcggggatgtgtac
cagtcaccatgcaccgtggcccagcggccccagaccttcaacagcagcgcgcgggtcagc
ctgtcgggaagcagtgacccccacctctgccgagatctggtttctgggctcttcagcttc
tcctcctgccccttctcccgatgctctttcaatggtgtcttccagcccccagtggctggg
aactttatcgccttctctgccttcttctacacggtggacttcttgcggacttccatgggg
ctacccgtggccaccctacagcagctggaggccgccgcagtgaacgtctgcaaccagacc
tgggctcagctgcaagctcgggtgccggggcaacaggcccacctggccgactactgcgcc
ggggccatgttcgtgcagcagctgctgagtcgcggctacggattcgacgagcgcgccttc
ggcggtgtgatcttccagaagaaggccgcggacactgcagtgggctgggcgctcggctac
atgctgaacctgactaacctgatccccgccgacccgccggggctgcgcaagggcacggac
ttcagctcctgggtcgtcctcctgctgctcttcgcctccgcgctgctggctgcgcttgtc
ctgctgctgcatcaggtgcactccgccaagctgccaagcaccatttag

DBGET integrated database retrieval system