KEGG   Macaca mulatta (rhesus monkey): 721735Help
Entry
721735            CDS       T01028                                 

Gene name
PPP1CA
Definition
protein phosphatase 1, catalytic subunit, alpha isozyme
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    721735 (PPP1CA)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    721735 (PPP1CA)
   04024 cAMP signaling pathway
    721735 (PPP1CA)
   04022 cGMP - PKG signaling pathway
    721735 (PPP1CA)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    721735 (PPP1CA)
  Cell growth and death
   04114 Oocyte meiosis
    721735 (PPP1CA)
  Cellular commiunity
   04510 Focal adhesion
    721735 (PPP1CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    721735 (PPP1CA)
  Endocrine system
   04910 Insulin signaling pathway
    721735 (PPP1CA)
   04921 Oxytocin signaling pathway
    721735 (PPP1CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    721735 (PPP1CA)
   04270 Vascular smooth muscle contraction
    721735 (PPP1CA)
  Nervous system
   04728 Dopaminergic synapse
    721735 (PPP1CA)
   04720 Long-term potentiation
    721735 (PPP1CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    721735 (PPP1CA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    721735 (PPP1CA)
  Substance dependence
   05031 Amphetamine addiction
    721735 (PPP1CA)
   05034 Alcoholism
    721735 (PPP1CA)
  Infectious diseases
   05168 Herpes simplex infection
    721735 (PPP1CA)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     721735 (PPP1CA)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     721735 (PPP1CA)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     721735 (PPP1CA)
Spliceosome [BR:mcc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    721735 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 427 aa AA seqDB search
MRQRADRRSMVSTSGAAAASAAAGPSRGAAHSPSSAPHASRHRPPFSSRATGLLQQCQHC
VHHCTQLCPWVQMQCLPPPPAPATELHSHLQQGAERGLLDATAGTAGWGASTTGAVQGSR
PGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPP
ESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR
YNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCD
LLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL
VTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR
NSAKAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcgcgccgaccgccgtagcatggtctccaccagcggcgcggccgccgcctcg
gcggctgccggccccagccgcggcgcggcccacagcccctcgagcgcgccacacgcctcc
aggcacaggccgccgttcagctccagggccacggggcttctccagcagtgccagcactgt
gttcaccactgcacccagctctgcccgtgggtgcagatgcaatgcctgccgcccccgcca
gcgccagccactgagcttcacagccacctgcagcaaggagcggaaagaggcctcctggac
gccaccgcaggtactgcagggtggggcgcttccaccacaggagccgtgcagggctcgcgg
cctggcaagaatgtacagctgacagagaacgagatccgcggcctgtgcctgaaatcccgg
gagattttcctgagccagcccattcttctggagctggaggcacccctcaagatctgcggt
gatatacacggccagtactatgaccttctgcgactatttgagtatggcggtttccctccg
gagagcaactacctctttctgggggactatgtggacaggggcaagcagtccttggagacc
atctgcctgctgctggcctataagatcaagtaccccgagaacttcttcctgctccgtggg
aaccacgagtgcgccagcatcaaccgcatctacggtttctacgatgagtgcaagagacgc
tacaacatcaaactgtggaaaacgttcactgactgcttcaactgcctgcccattgcggcc
atagtggacgaaaagatcttttgctgccacggaggcctctccccggacctgcagtccatg
gagcagattcggcggatcatgcggcccacagacgtgcctgaccagggcctgctgtgtgac
ctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgaccgtggcgtc
tcttttacctttggagccgaggtggtggccaagttcctccacaagcatgacttggacctc
atctgccgagcacaccaggtggtagaagatggctatgagttctttgccaagcggcagctg
gtgacacttttctcagctcccaactactgtggcgagtttgacaatgctggcgccatgatg
agcgtggacgagaccctcatgtgctccttccagatcctcaagcccgccgacaagaacaag
gggaagtacgggcagttcagtggcctgaaccctggaggccggcccatcaccccaccccgc
aattccgccaaagccaagaaatag

DBGET integrated database retrieval system