KEGG   Macaca mulatta (rhesus monkey): 722044Help
Entry
722044            CDS       T01028                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    722044 (RASGRP2)
   04015 Rap1 signaling pathway
    722044 (RASGRP2)
   04010 MAPK signaling pathway
    722044 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    722044 (RASGRP2)
   04062 Chemokine signaling pathway
    722044 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcactctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtacgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaagacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctctgccttcccggcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccggcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccttgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcacggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacctacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcagagaagctgctgcagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacagaactagtg
acggcgacaggcaactatggcaactaccggcgccggctggcagcctgtgtgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccttgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccaactg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccacctcggcccccggtgctggaggagtggacctcggctgccaaacctaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtgtcctatttcctgcgctccagctctgtgctggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgcccggtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtaagcctggaggggtct
gcaccctcaccctcacccacacacagccaccatcaccgcgccttcagcttctccctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagaccgtg
gaggatggggtttttgacatccacttgtaa

DBGET integrated database retrieval system