KEGG   Macaca mulatta (rhesus monkey): 722050Help
Entry
722050            CDS       T01028                                 

Gene name
ADI1, ARD, Fe-ARD, MTCBP-1, MTCBP1
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    722050 (ADI1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     722050 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     722050 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 179 aa AA seqDB search
MVQAWYMDDAPGDPRQPHRPDPDRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERN
YSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDKWIRIFME
KGDMITLPAGIYHRFTVDEKNYAKAMRLFVGEPVWTAYNRPADHFEARGQYMKFLAQTA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtacatggacgacgccccgggcgacccgcggcaaccccaccgcccc
gaccccgaccgcccggtgggcctggaacagctccggcggctgggggtgctctactggaag
ctggatgctgacaaatatgagaatgatccagaattagaaaagatccgaagagagaggaac
tactcctggatggacatcataaccatatgcaaagataaactaccaaattatgaagaaaag
attaagatgttttacgaggagcatttgcacttggacgatgagatccgctacatcctggac
ggcagcgggtacttcgacgtgagggacaaggaggacaagtggatccggatcttcatggag
aagggagacatgataacgctccccgcagggatctatcaccgcttcaccgtggacgaaaag
aactacgcgaaggccatgcggctgtttgtgggagaaccggtgtggacagcgtacaaccgg
cccgctgaccatttcgaagcccgcgggcagtacatgaaatttctggcacagacagcctag

DBGET integrated database retrieval system