KEGG   Macaca mulatta (rhesus monkey): 722050Help
Entry
722050            CDS       T01028                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mcc00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 320 aa AA seqDB search
MPILQKSGERGGGGQCLTPYLGSQLSSLNYCSEGAGRRQRHTQGTCDAYGELHPAPGASG
ELLTPGHGPQAGPRVPRAGPGLECLCLRKAEPWGLPRAGPASAPPPNPGFSALLRLPIKE
SAAAGLRARPYGSNTAPALRVMVQAWYMDDAPGDPRQPHRPDPDRPVGLEQLRRLGVLYW
KLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYIL
DGSGYFDVRDKEDKWIRIFMEKGDMITLPAGIYHRFTVDEKNYAKAMRLFVGEPVWTAYN
RPADHFEARGQYMKFLAQTA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccgatactgcaaaagtctggagagcggggaggtggaggacaatgtctcaccccatac
ctgggatcccagctgtcaagtctcaactattgctctgaaggtgcagggagacggcaacgg
catacacaaggcacgtgcgatgcctacggtgagcttcacccagcccccggcgcgtctgga
gaactgctgaccccgggccacgggcctcaggcaggtccgagggtgcccagggcagggccg
gggcttgaatgcctttgcctccgaaaagcggagccgtggggcctgccccgcgccggtcct
gcctccgccccgccgcccaatcccggcttctcggcgcttctacgtctccctataaaagaa
agcgcggccgccgggctccgagcgcggccctacggttcgaacacagctcccgctctgcgc
gtcatggtgcaggcctggtacatggacgacgccccgggcgacccgcggcaaccccaccgc
cccgaccccgaccgcccggtgggcctggaacagctccggcggctgggggtgctctactgg
aagctggatgctgacaaatatgagaatgatccagaattagaaaagatccgaagagagagg
aactactcctggatggacatcataaccatatgcaaagataaactaccaaattatgaagaa
aagattaagatgttttacgaggagcatttgcacttggacgatgagatccgctacatcctg
gacggcagcgggtacttcgacgtgagggacaaggaggacaagtggatccggatcttcatg
gagaagggagacatgataacgctccccgcagggatctatcaccgcttcaccgtggacgaa
aagaactacgcgaaggccatgcggctgtttgtgggagaaccggtgtggacagcgtacaac
cggcccgctgaccatttcgaagcccgcgggcagtacatgaaatttctggcacagacagcc
tag

DBGET integrated database retrieval system