KEGG   Macaca mulatta (rhesus monkey): 722068Help
Entry
722068            CDS       T01028                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03320  PPAR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04659  Th17 cell differentiation
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc04976  Bile secretion
mcc05160  Hepatitis C
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05216  Thyroid cancer
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    722068 (RXRA)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    722068 (RXRA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    722068 (RXRA)
   03320 PPAR signaling pathway
    722068 (RXRA)
   04919 Thyroid hormone signaling pathway
    722068 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    722068 (RXRA)
  Digestive system
   04976 Bile secretion
    722068 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    722068 (RXRA)
   05202 Transcriptional misregulation in cancers
    722068 (RXRA)
   05226 Gastric cancer
    722068 (RXRA)
   05216 Thyroid cancer
    722068 (RXRA)
   05222 Small cell lung cancer
    722068 (RXRA)
   05223 Non-small cell lung cancer
    722068 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    722068 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    722068 (RXRA)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    722068 (RXRA)
Nuclear receptors [BR:mcc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   722068 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 722068
NCBI-ProteinID: XP_014971889
Ensembl: ENSMMUG00000008183
UniProt: H9FY76
Position
15
AA seq 462 aa AA seqDB search
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgatttctccacccaggtgaattcctccctcacc
tccccgacggggcgaggctccatggctgcgccctcgctgcacccgtccctggggcctggc
atcggctccccggggcagctgcactctcccatcagcaccctgagctcccccatcaacggc
atgggcccgcccttctcggtcatcagctcccccatgggcccccactccatgtcggtgccc
accacacccactctgggcttcagcactggcagcccccagctcagctcacccatgaacccg
gtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctcaaggtcccc
gcccatccctcaggaaacatggcttccttcaccaagcacatctgcgccatctgcggggac
cgctcctcaggcaagcactacggggtgtacagctgcgaggggtgtaagggcttcttcaag
cggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgcctgattgac
aagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatg
aagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtg
gagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggaggctgagctg
gccgtggagcccaagactgagacctacgtggaggcgaacatggggctgaaccccagctcg
ccgaacgaccccgtcaccaacatttgccaagcagctgacaagcagctcttcacgctggtg
gagtgggccaagcggatcccacacttctcagagctgcccctggacgaccaggtcatcctg
ttgcgggcaggctggaatgaactgctcatcgcctccttctcccaccgctccatcgccgtg
aaggacgggatcctcctggccaccggactgcatgtccaccggaacagcgcccacagcgca
ggggtgggcgccatctttgacagggtgctgacagagctcgtgtccaagatgcgggacatg
cagatggacaagacggagctgggctgcctgcgcgccatcgtcctcttcaaccccgactcc
aaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctacgcgtccctg
gaggcctactgcaagcacaagtacccagagcagcccggaaggttcgccaagctgttgctc
cgcctgccggctctgcgctccatcgggctcaagtgcttggaacatctcttcttcttcaag
ctcattggggacacgcccattgacaccttcctcatggagatgctggaggcgccgcaccaa
atgacttag

DBGET integrated database retrieval system