KEGG   Macaca mulatta (rhesus monkey): 722173Help
Entry
722173            CDS       T01028                                 

Definition
6-phosphofructokinase, liver type-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mcc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mcc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcc00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 891 aa AA seqDB search
MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYESLPLYYL
GASRAQGWRDIVLLFGPPVPLLPRPGVPPMIPKGCLPPATSLKFLPTSVQGGTIIGSARC
KAFTTREGRRTAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELVAEGKISETT
AQTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQRWQHHSHLCGHW
FHLRVALQRCQGQWERPWVMTWLLEPSPVEPRGLAEIEPYRRGWPEGALHSHRTRALSEL
LPPCFCRRLCGLWQSPLVHRCQEGGGPSGPSVVSALALQASFPPAGFPTWQLSPVVSLTQ
TRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFD
RVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDE
AIQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISQG
HTVYVVHDGFEGLAKGQVQVVGWHNVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGI
HALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAM
ESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVE
HMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTP
FDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFSPVTELKKDT
DFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtggacctggagaagctgcgggcgtcgggcgcgggcaaggccatcggcgtc
ctgaccagcggcggcgacgcgcaaggcatgaacgctgctgtccgagctgtgacgcgcatg
ggcatttatgtgggtgccaaagtcttcctcatctatgagagccttccactctattacctt
ggggcttcccgagcccagggctggagggacatcgtcctcctctttggtccgccagtcccc
ttgctgcccaggcctggggtccctccgatgatccccaagggctgtctgccgcctgccacg
tccctgaagtttctgcccacttctgtgcagggcggcactatcattggcagcgcccgctgc
aaggcctttaccacccgggaggggcgccggacagcggcctacaacctggtccagcacggc
atcactaacctgtgcgtcatcggtggggacggcagcctcacgggtgccaacatcttccgc
agcgagtggggcagcctgctggaggagctggtggcggaaggtaagatctcagagaccaca
gcccagacctactcgcacctgaacatcgcgggcctggtgggctccatcgataacgacttc
tgcggcaccgacatgaccattggcacggactcggccctccaccgcatcatggaggtcatc
gatgccatcaccaccaccgcccagaggtggcagcatcactcccatctgtgtggacactgg
ttccacctccgcgtggctctacagcgctgccaagggcagtgggagagaccatgggtcatg
acctggcttctggaaccttccccagtggagcccaggggcttggcggagatagaaccctac
aggcgaggctggcccgagggagccctccactcccaccgcacccgggccctgtctgagctg
ctcccaccctgtttctgtaggaggctctgtggcctgtggcagagtcctcttgttcaccgc
tgccaggagggcgggggtcctagtgggcccagcgtggtctctgccctggcgctccaggcc
tcctttcctcctgctgggtttcccacctggcagctgagccctgtcgtgtctttgacccag
actcggagccgcgggtcccgactgaacatcatcattatcgctgagggtgccatcgaccgc
aacgggaagcccatctcgtccagctacgtgaaggacttggtggttcagaggctgggcttc
gacacccgtgtgactgtgctgggccacgtgcagcggggagggacgccctctgcctttgac
cgagtcctgagcagcaagatgggcatggaggcggtgatggcgctgctggaggccacccct
gacacgccggcctgcgtggtcagcctctcggggaaccagtcagtgcggctgcccctcatg
gagtgcgtgcagatgaccaaggaagtgcagaaagccatggatgataagaggtttgacgag
gccatccagctccgtggcgggagcttcgagaacaactggaacatttacaagctcctcgcc
caccagaagccccccaaggagaagtctaacttctccctggccatcctgaatgtgggggcc
ccagcggctggcatgaacgcggccgtgcgctcggcggtgcggaccggcatctcccagggc
cacacggtgtacgtcgtgcacgatggctttgaaggcctagccaagggtcaggtgcaagta
gtaggctggcacaacgtggccggctggttggggcgtggtggctccatgctggggaccaag
aggactctgcccaagggccagctggagtccatcgtggagaacatccgcatctatggtatc
catgccctgctggtggtcggcgggtttgaggcctatgaaggggtgctgcagctggtggag
gctcgagggcgttacgaggagctctgcatcgtcatgtgcgtcatcccagccaccatcagc
aacaacgtccctggcaccgacttcagcctgggctctgacactgctgtaaacgctgccatg
gagagctgtgaccgcatcaaacagtctgcctcggggaccaagcgccgtgtgttcatcgtg
gagaccatggggggttactgtggctacctggccaccgtgactggcatcgctgtgggggcc
gacgccgcctacgtctttgaggaccctttcaacatccatgacttaaaggtcaacgtggag
cacatgacggagaagatgaagacagacattcagaggggcctggtgctgcggaacgagaag
tgccatgactactacaccacggagttcctgtacaacctgtactcatcagagggcaagggt
gtcttcgactgcaggaccaacgtcctgggccacctgcagcagggcggcgccccaaccccc
tttgaccggaactacgggaccaagctgggggtgaaggccatgctttggttgtcggagaag
ctgcgtgaggtttaccgcaagggacgggtgtttgccaatgccccagactcggcctgcgtg
atcggcctgaagaagaaggcggtggccttcagccccgtcactgagctcaagaaagacact
gatttcgagcaccgcatgccgcgggagcagtggtggctgagcctgcggctcatgctgaag
atgctggcacagtaccgtatcagcatggccgcctacgtgtcaggggagctggagcacgtg
acccgtcgcaccctgagcatggacaagggcttctga

DBGET integrated database retrieval system