KEGG   Macaca mulatta (rhesus monkey): 722198Help
Entry
722198            CDS       T01028                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    722198 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    722198 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    722198 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    722198 (ARHGEF1)
   05205 Proteoglycans in cancer
    722198 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 571 aa AA seqDB search
MPRPLTGVECSKRLKAASWDGPSWGPNKASVHSPEPGDEGEPGRSGLELEPEEPPGWREL
VPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMADGLFFSLEELQNIF
PSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSF
ALEQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEE
PTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNL
DITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGK
TMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGS
LKVPAPASRPKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEG
QLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETM
KQLEELEEEFCRLRPLLSQLGGNSVSQPGCT
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggccactgactggggttgaatgctctaagaggttgaaggctgcttcctgggat
ggtccaagctggggccctaacaaggcctccgtccacagccctgagcctggagatgagggg
gagccggggcggtcaggactggagcttgaaccagaagagcctcctggctggcgggaactt
gtcccaccagacaccctgcatagcctgcccaagagccaggtgaagcggcaggaggtcatc
agcgagctgctggtgacggaagcggcccacgtgcgcatgctgcgggtgctgcacgacctc
ttcttccagcccatggcggacggcctcttcttctccctggaggagctgcagaacatcttc
cccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgcctgatgaagcgg
aggcaggagagtggctacctcatcgaggagattggagacgtgctgctggcccggtttgat
ggtgctgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtcgttt
gccttagagcagctcaaagccaagcaacgcaaggagcctcggttctgtgccttcgtgcag
gaagctgagagccgcccacggtgccgccgtctgcagctgaaggacatgattcccacggag
atgcagcggctgaccaagtaccccctgcttctgcagagcatcgggcagaacacagaagag
cccacggaacgggagaaagtagagctggcagccgagtgctgccgggaaattctgcaccac
gtcaaccaagccgtgcgtgacatggaggacctgctgaggctcaaggactatcagcggcgc
ctggacttgtcccaccttcgacagagcagcgaccccatgctaagcgagttcaagaacctg
gacatcaccaagaagaaattggtccacgagggcccactgacgtggcgggtgacaaaggac
aaggctgtggaggtgcatgtgctgctgctggatgacctgctgctgctgctccagcgccag
gatgagcggctgctgctcaagtcccatagccggacgctgacgcccacgcccgacggcaag
accatgctgcggcctgtgctgcggctcacctctgccatgacccgcgaggtggccaccgat
cacaaagccttctacgtcctttttacctgggaccaggaggcccagatatacgagctggtg
gcacagactgtgtcggagcggaagaactggtgtgccctcatcaccgagactgccggatcc
ctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacccga
gaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccggctgat
gcccggaccgagagaatcctcagtgacctcctgcccttctgcagaccaggccccgagggc
cagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgtttccggcg
gaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggcggcccc
ctgagcccagcacggacccaggaaatccaggagaacctgctcagcttggaggagaccatg
aagcagctggaggagctggaggaggaattttgccgcctgcgacccctcctgtctcagctt
ggggggaactctgtctcccagcctggctgcacttga

DBGET integrated database retrieval system