KEGG   Macaca mulatta (rhesus monkey): 722252Help
Entry
722252            CDS       T01028                                 

Gene name
ABO, Mamu_ABO, RH*ABO
Definition
(RefSeq) ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
  KO
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    722252 (ABO)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     722252 (ABO)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     722252 (ABO)
Glycosyltransferases [BR:mcc01003]
 Glycan extension
  ABO blood group
   722252 (ABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 402 aa AA seqDB search
MGARARRRRPFLAGVPGDPRPPPAPRCPHPSPASASPGGRRRAARTGRGRLELTPPHGCR
AEGGSGDQTLSHGGAAADADCYGVLSPRSLMPGSLERGFCTAFREPDGLQRVSLTRMVYP
QPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKL
FLETAEKHFMVGHRVHYYVFTDQPAAVPRVALGTGRQLSVLGVRAYKRWQDVSMRRMEMI
SDFCERRFLSEVDYLVCADVDMEFRDHVGVEILTPLFGTLHPAFYGSSREAFTYERRPQS
QAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANSIEAVWHDESHLNKYLLR
HKPTKVLSPEYLWDQQLLGWPAVLRKLRFVAVPKNHQAVRNP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcgcgcgaggaggcgccgtcccttcctagcaggggtccctggggacccccgg
ccgcctcccgcgcctcgctgtcctcacccgagtccggcttcggcaagtccgggcggccgg
cggcgggcggcgcggaccgggagggggcgcctcgagctcaccccgccccatggctgccgg
gcggaaggcggcagcggagaccagacgctgagccatggcggagctgctgcagacgctgac
tgttacggggtcctaagccccagaagcctaatgccaggaagcctggaacgggggttctgc
acggcttttagggaaccagacggtctgcagcgtgtctcattgacaaggatggtctacccc
cagccaaaggtgctgacaccctgtaggaaggacgtccttgtcgtgaccccttggctggct
cccattgtctgggagggcacgttcaacatcgacatcctcaacgagcagttcaggctccag
aacaccaccatcgggttaactgtgtttgccatcaaaaaatacgtggccttcctgaagctg
ttcctcgagacggcggagaagcatttcatggtgggccaccgggtccactactacgtcttc
actgaccagccggccgcggtgccgcgcgtggcgctggggaccggtcggcagctgtcggtg
cttggggtgcgcgcctataagcgctggcaggacgtgtccatgcgccgcatggagatgatc
agcgacttctgcgagcggcgcttcctcagcgaggtggattacctggtgtgcgcggacgtg
gacatggagttccgcgaccacgtgggcgtggagatcctgactccgctcttcggcaccctg
caccccgccttctacggaagcagccgggaggccttcacctacgagcgccggccccagtcc
caggcctacatccccaaggacgagggtgatttctactacatgggggcgttcttcgggggg
tcggtgcaggaggtgcagcggctcaccagggcctgccaccaggccatgatggtcgaccag
gccaacagcatcgaggccgtgtggcacgacgagagccatctgaacaagtacctgctgcgc
cacaaacccaccaaggtgctctcccccgagtacctgtgggaccagcagctgctgggctgg
cccgcggtcctgaggaagctgaggttcgtggcggtgcccaagaaccaccaggcggtccgg
aacccgtga

DBGET integrated database retrieval system