KEGG   Macaca mulatta (rhesus monkey): 722252Help
Entry
722252            CDS       T01028                                 

Gene name
ABO, RH*ABO
Definition
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:mcc00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 435 aa AA seqDB search
MGALAQPGREASLRGPRVPVRAGYPDAVAVSGLFPLHPPRSPPSMSCCFQHRPPDPGRGR
GSGLPCLAPSPTRVGREQPPYRKRGGASRRRGKPKCYTFLPMILFLMMLVLVLFGYGVLS
PRSLMPGSLERGFCTAFREPDGLQRVSLTRMVYPQPKVLTPWKDVLVVTPWLAPIVWEGT
FNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAV
PRVALGTGRQLSVLGVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCADVDMEFRDH
VGVEILTPLFGTLHPAFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQR
LTRACHQAMMVDQANSIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKL
RFVAVPKNHQAVRNP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgctggcgcagcctggccgggaggctagtctccggggtccccgggtcccggtg
agggcgggataccccgacgccgtggcggtctccggcctctttccgctccaccctccccgc
tccccgccttccatgagctgctgttttcagcaccgaccgcctgaccctggacgaggacga
ggctccgggctgccctgcctggcccccagccctacccgggttggccgtgaacagcctcca
taccgtaaacgcggaggcgcctcgagaaggcgaggaaaaccaaaatgctacacatttcta
cctatgatccttttcttaatgatgctggtcttggtcttgtttggttacggggtcctaagc
cccagaagcctaatgccaggaagcctggaacgggggttctgcacggcttttagggaacca
gacggtctgcagcgtgtctcattgacaaggatggtctacccccagccaaaggtgctgaca
ccctggaaggacgtccttgtcgtgaccccttggctggctcccattgtctgggagggcacg
ttcaacatcgacatcctcaacgagcagttcaggctccagaacaccaccatcgggttaact
gtgtttgccatcaaaaaatacgtggccttcctgaagctgttcctcgagacggcggagaag
catttcatggtgggccaccgggtccactactacgtcttcactgaccagccggccgcggtg
ccgcgcgtggcgctggggaccggtcggcagctgtcggtgcttggggtgcgcgcctataag
cgctggcaggacgtgtccatgcgccgcatggagatgatcagcgacttctgcgagcggcgc
ttcctcagcgaggtggattacctggtgtgcgcggacgtggacatggagttccgcgaccac
gtgggcgtggagatcctgactccgctcttcggcaccctgcaccccgccttctacggaagc
agccgggaggccttcacctacgagcgccggccccagtcccaggcctacatccccaaggac
gagggtgatttctactacatgggggcgttcttcggggggtcggtgcaggaggtgcagcgg
ctcaccagggcctgccaccaggccatgatggtcgaccaggccaacagcatcgaggccgtg
tggcacgacgagagccatctgaacaagtacctgctgcgccacaaacccaccaaggtgctc
tcccccgagtacctgtgggaccagcagctgctgggctggcccgcggtcctgaggaagctg
aggttcgtggcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system