KEGG   Macaca mulatta (rhesus monkey): 722330Help
Entry
722330            CDS       T01028                                 

Definition
6-phosphofructokinase type C-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    722330
   01230 Biosynthesis of amino acids
    722330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    722330
   00030 Pentose phosphate pathway
    722330
   00051 Fructose and mannose metabolism
    722330
   00052 Galactose metabolism
    722330
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    722330
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     722330
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     722330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 723 aa AA seqDB search
AVRGDWREXPGHWSHHFPCPGRRAWWSGGTIIGSARCQAFRTREGRLKAACNLLQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEQGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
ILPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKQQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
NT seq 2174 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtaaggggagactggagggagnagcctggccactggtcacaccacttcccttgtc
ctggccggcgtgcttggtggtcaggcgggacgatcattggcagtgcgcggtgccaggcct
tccgcacgcgggaaggccgcctgaaggccgcctgcaacctgctgcagcgcggcatcacca
acctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggagt
ggagcgggctgctggaggagctggccaggaatggccagatcgataaggaggccgtgcaga
agtacgcctacctcaacgtggtgggcatggtgggctccattgacaatgatttctgtggca
ccgacatgaccatcggcactgactccgccctgcataggatcatcgaggtcattgacgcca
tcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacact
gtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttccgg
agtctccgccagagcaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgtg
cccggaaaaaaagactgaatattattattgtggctgaaggagcaattgatacccaaaata
aacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctatgacacac
gtgtgaccatcctcgggcacgtgcagagaggagggaccccctcggcattcgacaggatct
tggccagccgcatgggggtggaggcagtcatcgccttgctagaggccaccccggacaccc
cagcttgcgtcgtgtcgctgaacgggaaccacgccgtgcgcctgccactgatggagtgcg
tgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggttc
ggctccgagggaggagctttgcgggcaacctgaacacctacaagcgactcgccatcaagc
tgccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaatgtaggggcgc
ccgcggccgggatgaacgcggccgtgcgttcagctgtgcgcgtgggcattgccgacggcc
acaggatgctcgccatctacgatggctttgatggcttcgccaagggccagatcaaagaaa
tcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaac
gcattctcccgggaaagtacctggaggagatcgccacgcagatgcgcacgcacagcatca
acgcgctactgatcatcggcgggtttgaggcctacctgggactcctggagctgtcagccg
cccgggaaaagcacgaggagttctgtgtgcccatggtcatggttcccgctactgtgtcca
acaatgtgccgggttccgatttcagcattggggcagacacagccctgaacactatcaccg
acacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatcg
agaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagccg
atgccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggagc
acctgacggagaaaatgaagaccaccatccagaggggccttgtgctcagaaatgagagct
gcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggcg
tgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccctctccat
ttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaaac
tcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgcgtgctgg
gaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagcagcaaacggatt
ttgagcacaggattcccaaagaacagtggtggctcaagctgcggcccctcatgaagatcc
tggccaagtacaaggccagctacgacgtgtcggactcaggccagctagagcacgtgcagc
cctggagcgtctga

DBGET integrated database retrieval system