KEGG   Macaca mulatta (rhesus monkey): 722330Help
Entry
722330            CDS       T01028                                 

Gene name
PFKP
Definition
(RefSeq) 6-phosphofructokinase type C-like
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    722330 (PFKP)
   01230 Biosynthesis of amino acids
    722330 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    722330 (PFKP)
   00030 Pentose phosphate pathway
    722330 (PFKP)
   00051 Fructose and mannose metabolism
    722330 (PFKP)
   00052 Galactose metabolism
    722330 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    722330 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    722330 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    722330 (PFKP)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     722330 (PFKP)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     722330 (PFKP)
Messenger RNA biogenesis [BR:mcc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     722330 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 723 aa AA seqDB search
AVRGDWREXPGHWSHHFPCPGRRAWWSGGTIIGSARCQAFRTREGRLKAACNLLQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEQGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
ILPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKQQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
NT seq 2174 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtaaggggagactggagggagnagcctggccactggtcacaccacttcccttgtc
ctggccggcgtgcttggtggtcaggcgggacgatcattggcagtgcgcggtgccaggcct
tccgcacgcgggaaggccgcctgaaggccgcctgcaacctgctgcagcgcggcatcacca
acctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggagt
ggagcgggctgctggaggagctggccaggaatggccagatcgataaggaggccgtgcaga
agtacgcctacctcaacgtggtgggcatggtgggctccattgacaatgatttctgtggca
ccgacatgaccatcggcactgactccgccctgcataggatcatcgaggtcattgacgcca
tcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacact
gtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttccgg
agtctccgccagagcaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgtg
cccggaaaaaaagactgaatattattattgtggctgaaggagcaattgatacccaaaata
aacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctatgacacac
gtgtgaccatcctcgggcacgtgcagagaggagggaccccctcggcattcgacaggatct
tggccagccgcatgggggtggaggcagtcatcgccttgctagaggccaccccggacaccc
cagcttgcgtcgtgtcgctgaacgggaaccacgccgtgcgcctgccactgatggagtgcg
tgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggttc
ggctccgagggaggagctttgcgggcaacctgaacacctacaagcgactcgccatcaagc
tgccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaatgtaggggcgc
ccgcggccgggatgaacgcggccgtgcgttcagctgtgcgcgtgggcattgccgacggcc
acaggatgctcgccatctacgatggctttgatggcttcgccaagggccagatcaaagaaa
tcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaac
gcattctcccgggaaagtacctggaggagatcgccacgcagatgcgcacgcacagcatca
acgcgctactgatcatcggcgggtttgaggcctacctgggactcctggagctgtcagccg
cccgggaaaagcacgaggagttctgtgtgcccatggtcatggttcccgctactgtgtcca
acaatgtgccgggttccgatttcagcattggggcagacacagccctgaacactatcaccg
acacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatcg
agaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagccg
atgccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggagc
acctgacggagaaaatgaagaccaccatccagaggggccttgtgctcagaaatgagagct
gcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggcg
tgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccctctccat
ttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaaac
tcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccgtttgcgtgctgg
gaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagcagcaaacggatt
ttgagcacaggattcccaaagaacagtggtggctcaagctgcggcccctcatgaagatcc
tggccaagtacaaggccagctacgacgtgtcggactcaggccagctagagcacgtgcagc
cctggagcgtctga

DBGET integrated database retrieval system