KEGG   Macaca mulatta (rhesus monkey): 722387Help
Entry
722387            CDS       T01028                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    722387 (POMT1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     722387 (POMT1)
Glycosyltransferases [BR:mcc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   722387 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 725 aa AA seqDB search
MWGFLKRPIVVTADINLSLVALTGMGLLSRLWRLTYPPAVVFDEVYYGQYISFYMKRIFF
LDDSGPPFGHMVLALGGYLGGFDGHFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGMFTYVLMLAVAAVHAWHLIGDQTLSNVCVFCHL
LARAVALLVIPVVLYLLFFYVHLILLFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
FGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGY
HESMVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFLELQWKMLVLRSDDSE
HKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWISGSLALAIYALLSLWYLLRQR
RNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPVVLQ
HISDHLCRSQLQRSVFSALVVAWYSSACHVSHTLRPLTYGDKSLSPHELKALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtggggatttttgaagcgccctatagtggtgacggctgacatcaacttgagcctcgtg
gccctgactgggatggggttactgagccggctgtggcgactcacgtacccgccggctgtg
gtttttgacgaagtgtattatgggcagtacatctctttttacatgaaacgaatcttcttc
ttggatgacagtgggccgccatttggccacatggtgctggccttgggaggttatttagga
ggattcgatggccattttttgtggaacagaattggagcagaatacagtagcaacgtgccc
gtgtggtccctgcgcctgctgccagcgcttgcgggggccttgtctgtccccatggcctac
cagatagtgctggagctccacttttctcattgtgccgccatgggagctgctctgttgatg
cttatcgagaatgctctcatcactcagtcaaggctaatgcttttggaatcagtgttaata
ttttttaatctattggccgtgttgtcctacctgaagttcttcaattgccaaaagcacagc
cctttttctctgagctggtggttctggctaacactgacaggggttgcttgttcctgcgca
gtgggcatcaagtacatgggtatgttcacatacgtgctcatgctggcggttgcagctgtc
catgcctggcacctaattggagaccagactttgtccaacgtctgtgtgttctgtcacttg
cttgcccgagcagtggctttgctggtcatcccggtcgtcctgtacttactgttcttctac
gtccatttgattctgctcttccgctctgggccccacgaccaaatcatgtccagtgccttc
caggccagcttagagggaggactagctcggatcacccagggtcagccgctggaggtggcc
tttgggtcccaggtcactctgaggaacgtctttgggaaacctgtgccctgctggctgcat
tcccaccaggacacctaccccatgatatatgagaacggccgaggcagctcccaccagcag
caggtgacctgttaccccttcaaagacgtcaataactggtggattgtaaaggatcccggg
aggcaccagctggtggtgagcagccctccgagacccgtgcggcacggggacatggtgcag
ctggtccacggcatgaccacccgctccctgaacacgcatgatgttgcagcccctctgagt
ccccattcacaggaggtctcctgctacattgactataatatctccatgcccgcccagaac
ctctggagactggaaattgtgaacagaggatccgacacagacgtctggaagaccatcctc
tcagaggtccgctttgtgcacgtgaacacttctgcggtcttaaagctaagcggggctcac
ctccctgactgggggtatcggcagctggagatcgtcggggagaagctgtcccggggctac
cacgagagcatggtgtggaacgtggaggagcaccgatacggcgcgagccaggagcagagg
gagcgggaacgggagctgcactcacctgcgcaggtggacgtcagcaggaacctcagcttc
atggcgagattcttggagctgcagtggaagatgctggtgctgagaagcgatgactcggaa
cacaagtatagctccagcccgctggagtgggtcaccctggacaccaatatcgcctactgg
ctgcaccccaggaccagcgctcagatccacctacttggaaacatagtgatctggatttca
ggcagcctcgccctggccatctacgccctgctgtccttgtggtacctgctccgacagcga
agaaacgtccatgacctccctcaggatgcctggctgcgctgggtgttggctggggcgctg
tgtgctggtggctgggcagtgaactacctcccgttcttcctgatggagaagacactcttc
ctctaccactacctgcccgcactcaccttccagatccttctgctccctgtcgtcctgcag
cacatcagcgaccacctgtgcaggtcccagctccagaggagcgtcttcagcgccctggtg
gtggcctggtactcctccgcatgccatgtgtcccacacgctgcgcccactcacctacggg
gacaagtcactctcgccacatgaactcaaggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system