KEGG   Macaca mulatta (rhesus monkey): 722430Help
Entry
722430            CDS       T01028                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma 3
  KO
K06247  
laminin, gamma 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    722430 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    722430 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    722430 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    722430 (LAMC3)
   05222 Small cell lung cancer
    722430 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    722430 (LAMC3)
   05145 Toxoplasmosis
    722430 (LAMC3)
Cell adhesion molecules and their ligands [BR:mcc04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     722430 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 1575 aa AA seqDB search
MAAAALLLGLALLAPRAAGSGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLL
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGID
CERCLPIFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCTCKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPHSGRCPCKENVEGNLCDRCRPGTFNLQPHNPVGCSSC
FCYGHSKVCAATAQFQVHHIFTDFHQGAEGWWARSVGGPEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFQVPPRSSPLPVQLRLEGAGLALSLRHSSLSGPQDTGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLTNLTSLRLRVSPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPSGYMGQFCESCAPGYKRETPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVACTHCPPG
QRGRRCEVCDDGFFGDPLGLSGPPQPCYQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTAG
DHCERCREGFYGSALVPRPADKCKPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCICRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYALV
KEEAAKLKAKLTLMEGWLQGSNCGSPWGPLDILLGEAPRGDIYQGHHLLPGVREAFLEQM
MGLEGAVKASREQLQRLSKGAHCAQAGAQKTCTQLADLEAVLESSEEEILHAAAILASLE
IPQDGPGQPTKWSHLATEARALAGSHRDTATKIAATAQRALLASNTSYALLWSLLEGRMA
LETQRDLEDRYQEVQAAQKALGTAMAEVLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSWAEDLSLKAKILEKTVASQQHMATKAARTLHAAAQAALRQTEPLTQLHQEARTALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVRDRLLADMRKKTKQA
ERMLGNAAPLSSSAKKKGREAEVLAKDSVKLAKALLREGNQVHRRASRLTSQTQATLQQA
SRQVLDSEARRQELEEAEQVGAGLSEMEQQIRESRISLEKDIEALSELLARLGSLDTHQA
PAQALNETQWALERLRLQLDSPGALQRKLRLLEQESEQQELQIQGFESDLAEIRADKRNL
EAILHSLPENCASWQ
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgctcctgctagggctggcgctgctggcacctcgggcggccggctcg
ggcatgggcgcgtgctacgacggcgcggggcgcccgcagcgctgcctgcccgtgttcgag
aacgcggccttcggccggctagcccaggcctcgcacacgtgcggcagcccgcctgaggac
ttctgcccccacgtgggcgccgcgggcgcgggggcgcagtgccagcgctgcgacgcagcc
gacccccagcgccaccacaatgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgtctggggaaggcttacgagatcacgtatgtgaggctaaagttccacaccagt
cgccctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctac
cagttctacagtgcctcctgtcagaagacttacggccggcccgagggccagtacctgctc
cctggcgaggatgagcgcgtggccttctgcacctcagagttcagcgacatctccccgctg
agtgggggcaatgtggccttctccaccctggagggccggcccagcgcctacaacttcgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggatgacatcttcaaggaccccaaggtgctccagtcctactactat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgt
ggccccgacgcggcgggccagttggcctgccggtgccagcacaacaccaccggcatagac
tgtgagcgctgcctgcccatcttccaggaccgtccgtgggcccggggcactgctgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgttcgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccattcggcaggctctctgcacctccagtgcgatgacacaggcacc
tgcacctgcaagcccactgtgactggctggaagtgtgatcgctgtctgcccgggttccac
tcgctcagcgagggaggctgcagaccctgcacctgcaatcccgctggcagcctggacacc
tgtgacccccacagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgac
agatgtcgccccgggacttttaacctgcagccccacaatccggtcggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcggctactgcccagttccaagtgcatcacatc
ttcaccgatttccaccagggagccgaaggctggtgggccagaagtgtggggggccccgag
caccccccacaatggagcccaaatggggtcctcctgagcccagaagacgaggaggagctc
acagcaccagagaaattcctgggagatcagcggttcagctatgggcagcccctcatcctg
accttccaggtgccccccaggagctccccactccctgtgcagctgaggctggaaggggcg
ggcttggccctgtccctgaggcactctagcttgtctggcccccaggataccgggcatccc
agggaggtagagctcaggttccacctgcaggagacctctgaggatgtggcccctccgctg
ccccccttccacttccagcggctcctcaccaacctgaccagcctccgcctccgtgtcagt
cccggccccagccctgctggccaagtgttcctgactgaggtccgactcacatccgcccgg
ccagggctttccccgccagcctcctgggtggagacttgttcatgtcccagtggctacatg
ggccagttctgtgaatcctgtgctccgggatataagagggagacgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgcgtctgcagccaccataccgagggcccatcctgtgaacgctgcttgccgggtttc
tatggcaaccccttcgcgggccaagccgatgactgccagccctgtccctgccctggccag
tcggcctgcacgaccatcccagagagcggggaggtggcatgcacccactgccccccgggc
cagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctc
tcggggcccccccagccctgctaccagtgccagtgcagcgggaatgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccgcgggt
gaccactgtgagcgctgtcgtgaaggtttctacgggagcgccctggtccctcggcctgca
gacaaatgcaagccctgcagctgccacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccagtgctcctgcctgcctcacgtgactggacgggactgtagccgc
tgctaccctggcttcttcgacctccagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacagatgccagctgggtttctttggcttctccatcaag
ggctgccgggcctgcaggtgctccccactgggcgctgcctcagcccagtgccacgagaac
ggcacctgcatatgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagatggcacacactgccaggaatgcccgtcctgctatgccctggtg
aaggaggaggcagccaagctgaaggccaaactgactttgatggaggggtggctgcaaggg
tccaactgtggcagtccctggggaccactagacattctgctgggagaggccccgaggggg
gacatctaccagggccaccacctgcttccaggggttcgggaagccttcctggaacagatg
atgggccttgaaggtgctgtgaaggcctcccgggagcagctgcagaggctgagcaagggt
gcccactgtgcccaggccggagcccagaagacctgtacccagctggcagacctggaggca
gtgctggagtcctcggaagaggagattctgcacgcagctgccattctcgcgtctctggag
attccccaggatggtcccggccaacccaccaaatggagccacctggccacagaggcccgt
gccctcgcggggagccacagagacaccgccaccaagattgcagccactgctcagagggcc
ctgctcgcctccaacaccagctacgcgcttctctggagtctgctggagggaaggatggcc
ctggagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctggggacggctatggcagaggtgctgcctgaagcggaaagcgtgttggccacagtgcag
caagttggcgcagatacagccccgtacctggctttgctggcttccccgggagctctgcct
cagaagtcctgggctgaagacctgagcctgaaggcgaagatcctggagaagacagttgcg
tcacaacagcacatggccaccaaggctgcccgaaccctccatgctgctgcccaggcagcg
ctacggcaaacagagcccctcacacagctacaccaggaggccagaaccgccctgacccag
gcttcctcatctgtccaggctgccacagtgaccgtcatgggagccaggactctgctggct
gacctggaaggaatgaagctgcagtttcctcggcccaaggaccaggcggcactgcagagg
aaggcagactccgtcagggacagactccttgcagacatgagaaagaagaccaagcaggcg
gagaggatgctaggaaacgcggcccctctttcctccagtgccaagaagaaaggcagagaa
gcagaagtgttggccaaggacagtgtcaagcttgccaaggccttgctgagggaggggaac
caggtgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaacaggcg
tcccggcaggtgctggattctgaagcacgccgacaagagctggaggaagctgagcaggtg
ggtgctgggctgagcgagatggagcagcagatccgggaatcacgcatctccctggagaag
gacattgaggccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcc
ccagcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctggac
tccccgggggccttgcagaggaaactcaggctgctggagcaggaatctgagcagcaggag
ctgcagatccaaggcttcgagagtgacctcgccgagatccgcgctgacaaacggaacctg
gaggccattctgcacagcctgcctgagaactgtgccagctggcagtga

DBGET integrated database retrieval system