KEGG   Macaca mulatta (rhesus monkey): 722723Help
Entry
722723            CDS       T01028                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00062  Fatty acid elongation
mcc00071  Fatty acid degradation
mcc00280  Valine, leucine and isoleucine degradation
mcc00310  Lysine degradation
mcc00380  Tryptophan metabolism
mcc00410  beta-Alanine metabolism
mcc00640  Propanoate metabolism
mcc00650  Butanoate metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01212  Fatty acid metabolism
Module
mcc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mcc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mcc_M00085  Fatty acid biosynthesis, elongation, mitochondria
mcc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    722723 (ECHS1)
   00650 Butanoate metabolism
    722723 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    722723 (ECHS1)
   00071 Fatty acid degradation
    722723 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    722723 (ECHS1)
   00310 Lysine degradation
    722723 (ECHS1)
   00380 Tryptophan metabolism
    722723 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    722723 (ECHS1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     722723 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 722723
NCBI-ProteinID: XP_015004002
Ensembl: ENSMMUG00000046481
UniProt: A0A1D5QGP4
Position
9
AA seq 290 aa AA seqDB search
MAALRVLLPRLRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIEELNQALKTFEEDTGVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSNKFLKHW
DYLTQMKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIASNSKIIVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcgtgtcctgctgccccggctccgcggcccgctgaggcccccggttcgc
tgtcctgcgtggcgtcccttcgcctcgggtgctaactttgagtacatcatcgcagaaaaa
agagggaagaataacaccgtggggttgatccaactgaaccgccccaaggccctcaatgca
ctttgcgatggcctgattgaggagctcaaccaggcactgaagaccttcgaggaggacacg
ggcgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacctgagtttccaggactgttactccaacaagttcttgaagcactgg
gactacctcacccagatgaagaagccagtcatcgctgctgtcaatggctatgcctttggc
gggggctgtgagcttgccatgatgtgtgatatcatctatgccggcgagaaggcccagttt
gcacagccggagatcttactaggaaccatcccaggtgcgggtggcacccagagactcacg
cgtgctgttgggaagtcgctggcaatggagatggtcctcaccggtgaccggatctcagcc
caggacgccaagcaagcaggtctcgtaagcaagatttttcctgttgagacactggtggaa
gaagccatccagtgtgcagaaaaaattgccagcaattctaaaattatagtagccatggcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaagtaagttagagaag
aaactcttctactcaacctttgccaccgatgaccggaaagaagggatgactgcgtttgtg
gaaaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system