KEGG   Macaca mulatta (rhesus monkey): 722723Help
Entry
722723            CDS       T01028                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain, 1, mitochondrial
  KO
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    722723 (ECHS1)
   01212 Fatty acid metabolism
    722723 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    722723 (ECHS1)
   00650 Butanoate metabolism
    722723 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    722723 (ECHS1)
   00071 Fatty acid degradation
    722723 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    722723 (ECHS1)
   00310 Lysine degradation
    722723 (ECHS1)
   00380 Tryptophan metabolism
    722723 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    722723 (ECHS1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     722723 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 290 aa AA seqDB search
MAALRVLLPRLRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIEELNQALKTFEEDTGVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSNKFLKHW
DYLTQMKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIASNSKIIVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcgtgtcctgctgccccggctccgcggcccgctgaggcccccggttcgc
tgtcctgcgtggcgtcccttcgcctcgggtgctaactttgagtacatcatcgcagaaaaa
agagggaagaataacaccgtggggttgatccaactgaaccgccccaaggccctcaatgca
ctttgcgatggcctgattgaggagctcaaccaggcactgaagaccttcgaggaggacacg
ggcgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacctgagtttccaggactgttactccaacaagttcttgaagcactgg
gactacctcacccagatgaagaagccagtcatcgctgctgtcaatggctatgcctttggc
gggggctgtgagcttgccatgatgtgtgatatcatctatgccggcgagaaggcccagttt
gcacagccggagatcttactaggaaccatcccaggtgcgggtggcacccagagactcacg
cgtgctgttgggaagtcgctggcaatggagatggtcctcaccggtgaccggatctcagcc
caggacgccaagcaagcaggtctcgtaagcaagatttttcctgttgagacactggtggaa
gaagccatccagtgtgcagaaaaaattgccagcaattctaaaattatagtagccatggcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaagtaagttagagaag
aaactcttctactcaacctttgccaccgatgaccggaaagaagggatgactgcgtttgtg
gaaaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system