KEGG   Mycoplasma crocodyli: MCRO_0184Help
Entry
MCRO_0184         CDS       T01205                                 

Definition
(RefSeq) ROK family hexose kinase
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcd  Mycoplasma crocodyli
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCRO_0184
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0184
   00052 Galactose metabolism
    MCRO_0184
   00500 Starch and sucrose metabolism
    MCRO_0184
   00520 Amino sugar and nucleotide sugar metabolism
    MCRO_0184
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCRO_0184
   00524 Butirosin and neomycin biosynthesis
    MCRO_0184
Enzymes [BR:mcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCRO_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178545..179441
Genome map
AA seq 298 aa AA seqDB search
MINNNKIAAVDIGGTNTRFALFDQNGKIKLKEKTSSSFDDSHLTCNWILELVNKYNIEHL
ALCIPGPSDYEKGLIINPPNLRGSWLNFDMKSYLLKNSKLKTIIFENDANAMALSNHREY
KIDKNKVSQFYTISTGFGSGLIINDSIYHGKNYLAQEVAQIPVCSKSFELTHHMRNNYAL
ELHCSGKGLEVKAKALKIANSTQEVFELAKSGNKDAIELLNTAVDTLARMIAINAGMLAP
HNYFIGGSVALNNKWFIDQAVEKAKIMSDPIHLNGVNFYYDKNGDDSALYGLYHLIQK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgataaacaataataaaattgccgctgtcgatataggtggcacaaacacccgttttgct
ctatttgatcaaaacggaaaaattaaactaaaagaaaaaacttcgtcaagttttgatgat
tcgcacttaacatgtaactgaatacttgaattagttaataaatataatatagaacatctt
gctctttgtattcctggaccaagtgattatgaaaaaggtttaattataaaccctccaaat
ttaagaggttcatgattaaattttgatatgaaaagttacttactaaaaaattcgaaattg
aaaacaataatttttgaaaatgacgctaatgcaatggctttatcaaatcaccgtgagtat
aaaattgacaaaaataaagttagtcaattttatacaataagtactggctttggtagtgga
ttaataattaatgattctatttatcatggaaaaaattacttagctcaagaggttgcacaa
atacctgtttgctcaaaatcatttgaacttacacatcatatgagaaacaattatgctctt
gaacttcattgctcaggaaaaggtttagaagtaaaagctaaagcattaaaaattgctaat
tcaacccaagaagtatttgaattagcaaaatctggcaataaagatgcaatcgaattgttg
aacacagccgttgatacacttgcaagaatgatagctattaatgcaggtatgttagcccca
cataattactttataggtgggagtgttgcattaaataacaaatgatttattgatcaagca
gttgaaaaagcaaaaataatgtctgatccaattcatttaaatggtgtaaatttctattat
gataaaaatggagatgacagtgccttatacggtttatatcacttaatccaaaaataa

DBGET integrated database retrieval system