KEGG   Mycoplasma crocodyli: MCRO_0184Help
Entry
MCRO_0184         CDS       T01205                                 

Definition
ROK family hexose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcd  Mycoplasma crocodyli
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCRO_0184
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0184
   00052 Galactose metabolism
    MCRO_0184
   00500 Starch and sucrose metabolism
    MCRO_0184
   00520 Amino sugar and nucleotide sugar metabolism
    MCRO_0184
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCRO_0184
   00524 Butirosin and neomycin biosynthesis
    MCRO_0184
Enzymes [BR:mcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCRO_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178545..179441
Genome map
AA seq 298 aa AA seqDB search
MINNNKIAAVDIGGTNTRFALFDQNGKIKLKEKTSSSFDDSHLTCNWILELVNKYNIEHL
ALCIPGPSDYEKGLIINPPNLRGSWLNFDMKSYLLKNSKLKTIIFENDANAMALSNHREY
KIDKNKVSQFYTISTGFGSGLIINDSIYHGKNYLAQEVAQIPVCSKSFELTHHMRNNYAL
ELHCSGKGLEVKAKALKIANSTQEVFELAKSGNKDAIELLNTAVDTLARMIAINAGMLAP
HNYFIGGSVALNNKWFIDQAVEKAKIMSDPIHLNGVNFYYDKNGDDSALYGLYHLIQK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgataaacaataataaaattgccgctgtcgatataggtggcacaaacacccgttttgct
ctatttgatcaaaacggaaaaattaaactaaaagaaaaaacttcgtcaagttttgatgat
tcgcacttaacatgtaactgaatacttgaattagttaataaatataatatagaacatctt
gctctttgtattcctggaccaagtgattatgaaaaaggtttaattataaaccctccaaat
ttaagaggttcatgattaaattttgatatgaaaagttacttactaaaaaattcgaaattg
aaaacaataatttttgaaaatgacgctaatgcaatggctttatcaaatcaccgtgagtat
aaaattgacaaaaataaagttagtcaattttatacaataagtactggctttggtagtgga
ttaataattaatgattctatttatcatggaaaaaattacttagctcaagaggttgcacaa
atacctgtttgctcaaaatcatttgaacttacacatcatatgagaaacaattatgctctt
gaacttcattgctcaggaaaaggtttagaagtaaaagctaaagcattaaaaattgctaat
tcaacccaagaagtatttgaattagcaaaatctggcaataaagatgcaatcgaattgttg
aacacagccgttgatacacttgcaagaatgatagctattaatgcaggtatgttagcccca
cataattactttataggtgggagtgttgcattaaataacaaatgatttattgatcaagca
gttgaaaaagcaaaaataatgtctgatccaattcatttaaatggtgtaaatttctattat
gataaaaatggagatgacagtgccttatacggtttatatcacttaatccaaaaataa

DBGET integrated database retrieval system