KEGG   Mycoplasma crocodyli: MCRO_0264Help
Entry
MCRO_0264         CDS       T01205                                 

Gene name
ruvA_1
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcd  Mycoplasma crocodyli
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mcd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260310..260915
Genome map
AA seq 201 aa AA seqDB search
MTIYKFGEIVYKKNKNLILESYGTGYMIQVACADRFELNTKLKMHLAYIYNEFAKTFSIY
GFKDYMERILFLDLINVNGIGAKIAMNILDNGWETVADLVASANYETLSKLNFVNEKNAR
NIILSLQDKWKKIRNVSNSNETAKNINALSDVSESLKMLGFKEKQISYALSKIKISEQLE
DMVEQSIKLIANKYHENRPTT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacaatatataaatttggagaaatagtttataaaaaaaataaaaacttaatattagaa
agttatggcacaggctacatgatacaagtagcttgtgctgatcgatttgaattaaatact
aaattaaaaatgcacttagcttatatttataatgaatttgctaaaacattttcaatatat
ggatttaaggattatatggaaagaatattatttttagatcttattaatgtaaatggtatt
ggagctaaaatagcaatgaatatattggacaacggttgagaaacagttgctgatttagtt
gctagtgcaaattatgaaaccttgagcaaattaaattttgttaatgaaaaaaatgctaga
aatattattttaagtttacaagataaatgaaagaaaataaggaatgtttctaatagcaat
gaaacagcgaaaaacattaatgcattatctgatgtttcagaatcgctcaaaatgcttgga
tttaaagaaaagcaaatttcttatgctctttcaaaaattaaaatttcagaacaattagaa
gacatggtagaacaaagtattaaattaattgcaaataaatatcatgaaaacagacctacg
acctag

DBGET integrated database retrieval system