KEGG   Mycoplasma crocodyli: MCRO_0264Help
Entry
MCRO_0264         CDS       T01205                                 

Gene name
ruvA_1
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcd  Mycoplasma crocodyli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCRO_0264 (ruvA_1)
Enzymes [BR:mcd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCRO_0264 (ruvA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260310..260915
Genome map
AA seq 201 aa AA seqDB search
MTIYKFGEIVYKKNKNLILESYGTGYMIQVACADRFELNTKLKMHLAYIYNEFAKTFSIY
GFKDYMERILFLDLINVNGIGAKIAMNILDNGWETVADLVASANYETLSKLNFVNEKNAR
NIILSLQDKWKKIRNVSNSNETAKNINALSDVSESLKMLGFKEKQISYALSKIKISEQLE
DMVEQSIKLIANKYHENRPTT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacaatatataaatttggagaaatagtttataaaaaaaataaaaacttaatattagaa
agttatggcacaggctacatgatacaagtagcttgtgctgatcgatttgaattaaatact
aaattaaaaatgcacttagcttatatttataatgaatttgctaaaacattttcaatatat
ggatttaaggattatatggaaagaatattatttttagatcttattaatgtaaatggtatt
ggagctaaaatagcaatgaatatattggacaacggttgagaaacagttgctgatttagtt
gctagtgcaaattatgaaaccttgagcaaattaaattttgttaatgaaaaaaatgctaga
aatattattttaagtttacaagataaatgaaagaaaataaggaatgtttctaatagcaat
gaaacagcgaaaaacattaatgcattatctgatgtttcagaatcgctcaaaatgcttgga
tttaaagaaaagcaaatttcttatgctctttcaaaaattaaaatttcagaacaattagaa
gacatggtagaacaaagtattaaattaattgcaaataaatatcatgaaaacagacctacg
acctag

DBGET integrated database retrieval system