KEGG   Mycoplasma crocodyli: MCRO_0483Help
Entry
MCRO_0483         CDS       T01205                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcd  Mycoplasma crocodyli
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCRO_0483 (pfkA)
   01230 Biosynthesis of amino acids
    MCRO_0483 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0483 (pfkA)
   00030 Pentose phosphate pathway
    MCRO_0483 (pfkA)
   00051 Fructose and mannose metabolism
    MCRO_0483 (pfkA)
   00052 Galactose metabolism
    MCRO_0483 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MCRO_0483 (pfkA)
Enzymes [BR:mcd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCRO_0483 (pfkA)
Protein phosphatases and associated proteins [BR:mcd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCRO_0483 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574169..575146)
Genome map
AA seq 325 aa AA seqDB search
MKKIAILTSGGDAPGMNPALCAIIRCAKSNGLTPYIVYEGFKGLYENNIKLTDDLDLDHV
QSQGGTAIYSARFPEFKNEEVRNVAIENLMKKGIDSLIVIGGDGSYMGAQLLHEKGFKTI
GIPGTIDNDIASSDYTIGYDTALNTIVDSIDKIRDTATSHKRIMIVEVMGNECGDLALYS
GLATGAEIIATSDHVISIPDMANLAYELTLQEKRRSVIIIVSEKRYDLKYLEKAIEEKTK
WTTRATSLAHVQRGGRPTAQERILSSLFGIKAVELILEGKSGLAIGVINNDIVGTPILEA
LSMVNKAKEKARVKLQKYNKLNKIL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcgattttaacttcaggtggagatgcaccaggaatgaaccctgcttta
tgcgcaattattagatgtgcaaaaagtaatggattaactccttatattgtttatgaaggt
tttaaagggttgtatgagaataatattaaattaacagatgatctagatttagaccacgtt
caatcacaaggtggaacagctatctattcagctcgttttccagaatttaagaatgaagaa
gtaagaaatgtagccatagaaaatctaatgaaaaaaggtattgattcactaatagtaatt
ggtggagatggaagttatatgggtgctcaattgttgcatgaaaaaggtttcaaaacaatt
ggaattcctggaacaattgataacgatatagcatcaagtgattatactataggatatgat
acagcacttaatacaatcgttgattctattgacaaaattagagatacagcaacttcacat
aaaagaattatgattgttgaagtaatggggaatgaatgtggtgatttagctctttatagt
ggtctagcaactggtgctgaaattatagcaacaagtgaccatgttatttcaattcctgat
atggcaaatctagcttatgaattaaccttacaagaaaaaagaagaagtgttattatcatt
gtttcagaaaagagatatgacttaaaatatcttgaaaaagcaattgaagaaaaaacaaaa
tgaactacaagagcaacttctttggcccatgttcaaagaggtggaagaccaactgcacaa
gaaagaatcctttcatcgttatttggtataaaagcagttgaattaattcttgaaggtaaa
tcgggtttagctataggagtaattaataatgatattgttgggacaccaatacttgaagcg
ttaagcatggttaataaagcaaaagaaaaagcaagagtaaaacttcaaaaatataataaa
ttaaataaaattttataa

DBGET integrated database retrieval system