KEGG   Mycoplasma crocodyli: MCRO_0568Help
Entry
MCRO_0568         CDS       T01205                                 

Gene name
xfp
Definition
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mcd  Mycoplasma crocodyli
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCRO_0568 (xfp)
Enzymes [BR:mcd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MCRO_0568 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667930..670308
Genome map
AA seq 792 aa AA seqDB search
MKKTVYDTELYIEKLDAWFRAANYLSVGQMYLRNNPLLRNKITKDDVKVYPIGHWGTIPG
QNFAYAHLNRVINKYDLNMFYIEGPGHGGQVMTSNSYLDGSYTELFPHVTQDLDGMKHLF
KYFSFPGGTASHAAPETPGSIHEGGELGYSLSHATGAILDNPNVIAATIVGDGESETGPL
AAGWFSNSFINPVNDGAVLPILHLNGGKISNPTILCRKSNEELTNYFLGMGWEAIFVEGE
DVQKMHKLMATKLDYAIERILSIQKEARKGKAEEATRPLWPMIVLRTPKGWTGPQKWNSD
QIVGSFRAHQVPIPVNSENMTHIDALVDWLKSYNVDNLFDKKGKLVPEIAEIAPVGDRRM
GMNPVTNGGLNPRNLALPNWQDFALNLEKPGAKIAQDMVELGSYFAKVMEMNKDNFRLFG
PDETKSNRLFNVFKVTSRQWLEPINPLFDEALSPAGRVIDSQLSEHQAEGFLEGYVLTGR
HGVFASYESFLRVVDSMLTQHMKWLKKANDVSWRNDYPSLNVIATSTAFQQDHNGYTHQD
PGLIGHLADKTPELIRQYLPADTNTLLAVMDKSLTERNVINHIIASKQPREQFYSAKEAA
ELVEKGLKVIKWASTVEGNDEPDLVVAAAGTEPNLEALAAITILNKEFPKLKIRFVNVVD
LMKLRHPSIDPRGITDKEFDKIFTKDKPVLFAFHGYEGILRDIFFKRNNHNLIAHGYREN
GDITTSFDIRQLSHMDRFHMAASAAVAALGKKANAFETKMLETIDFHTKYIREYGTDIPE
VKEWKWNPLVRK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaactgtttacgatacagaactatacatcgaaaaacttgatgcttggtttaga
gcagcaaattatttgtctgttggacaaatgtatttaagaaataatccattacttagaaat
aaaattactaaggatgatgttaaagtttaccctattggtcactgaggaacaatacctggt
caaaactttgcatatgctcatttaaatagagtaattaataaatatgatcttaatatgttt
tatattgaagggccaggacacggtggacaagttatgacatctaactcatatttagatggt
tcatatactgaattattcccccatgtaacacaagacctagatggaatgaaacacttattt
aaatatttctcattccctggtggaacagcatcacatgctgctcctgaaactccaggatca
atacatgaaggtggtgaattaggttattcattatcacatgcaacaggagcaatattagat
aaccctaatgtcattgctgctacaatagttggagatggtgaatcagaaactgggccgctc
gctgctggttgattctcaaattcattcattaaccctgttaatgatggagctgttttacca
atacttcacttaaatggtggaaaaatttctaaccctacaattttatgtagaaaatctaat
gaagaattaactaattactttttaggaatgggttgagaagctatttttgttgaaggtgaa
gatgttcaaaaaatgcataaattaatggcaactaaattagattatgctattgaaagaatt
ctatcaattcaaaaagaagctagaaaaggtaaggctgaagaagctacaagaccattgtga
ccaatgattgttctaagaacaccaaaaggttgaactggacctcaaaaatgaaacagtgac
caaatagtaggaagttttagagcacaccaagttccaattcctgttaactcagaaaatatg
acacatattgatgcattagttgattgacttaaatcatataatgttgataatttgtttgat
aaaaaaggtaaattagttcctgaaattgctgaaatagcaccagttggtgatagaagaatg
ggaatgaatcctgttacaaacggtggattaaatcctagaaatcttgcattaccaaattga
caagactttgcacttaatttagaaaaaccaggagcaaaaattgcgcaagacatggttgaa
ttaggttcatactttgctaaagttatggaaatgaataaagataactttagactttttggt
cctgatgaaacaaaatcaaaccgtctatttaatgtatttaaagttacaagccgtcaatga
ttagaacctattaatccactttttgatgaagctctttcaccagcaggtagagttattgat
tcgcaactttcagaacaccaagcagaaggatttttagaaggttatgttttaactggaaga
catggtgtttttgctagttatgaatcatttttaagagttgttgattcaatgttaacacaa
cacatgaaatgattaaagaaagcaaatgatgtttcatgaagaaatgattatccttcattg
aatgttattgcaacatcaacagctttccaacaagatcataatggttatacacatcaagat
ccaggacttattggacatttagctgataaaacaccggaattgattagacaatacttacca
gctgatacaaatactttattagctgttatggataaatcattaacagaaagaaacgtaatc
aatcatattatagcttcaaaacaacctagagaacaattctattcagcaaaagaagctgca
gaattagttgaaaaaggtttaaaagtaatcaaatgagcttcaacagtcgaaggaaatgat
gaaccagatttagttgttgcagccgctggaacagaacctaacttagaagcgttagcagca
attacaattcttaacaaagaattccctaaactaaaaattagatttgttaatgttgttgat
ttaatgaaattaagacacccatcaattgacccgagaggaataactgataaagaatttgat
aaaatctttacaaaagataaaccagttctattcgctttccatggatatgaaggaatatta
agagatatattctttaaacgtaataaccataatttaattgcacatggttatagagaaaat
ggtgatattacaacatcatttgatattcgtcaattaagtcatatggacagattccatatg
gcagcaagcgctgctgttgccgctcttggtaagaaagcaaatgcttttgaaacaaaaatg
cttgaaacaattgatttccatacaaaatatattcgtgaatacggaacagacattcctgaa
gtcaaagaatgaaaatgaaacccattagttagaaaataa

DBGET integrated database retrieval system