KEGG   Mycoplasma crocodyli: MCRO_0587Help
Entry
MCRO_0587         CDS       T01205                                 

Gene name
adhT
Definition
(RefSeq) alcohol dehydrogenase, propanol-preferring (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mcd  Mycoplasma crocodyli
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MCRO_0587 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCRO_0587 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    MCRO_0587 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MCRO_0587 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCRO_0587 (adhT)
   00626 Naphthalene degradation
    MCRO_0587 (adhT)
Enzymes [BR:mcd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MCRO_0587 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(694750..695799)
Genome map
AA seq 349 aa AA seqDB search
MAKKMKAFVVREPRKWSVELVDIPEPKEKEVLIKMETSGVCHTDLHAANFDWLVTPKYPL
IPGHEGIGIVEKLGPGCTHLKVGQRVCLAWLHDACGHCEFCLTGKETLCPNQNMSAYTKD
GSFAEYAIGHEDYVGVVPKDLDIITGAPVVCAGVTTYKAVKQAKLKPGEYVAVIGVGGLG
QMAVQYAKAMGYRPIGIDLSDEKCKLAIKSGAEYAFNSKKVDVVAKVLEVTNGGVHGVIN
TSVATAAAVQGMSILRRGGRQVLVGLPAKDSHGKDEFPVSVFWTVLCERELAGSIVGTRK
DLAEALDYAARGLVKSEVTKVIKLEEVASIFEKLEKGEFLGRAVIDYRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaatgaaagcgtttgtagtacgcgaacctagaaaatgaagtgtggaatta
gttgatattccagaaccaaaggaaaaagaagttctaattaaaatggaaaccagtggagtt
tgtcatacagacttacacgcagctaatttcgattgattagtaacacctaaatatccttta
attccaggacacgaaggaattggaattgttgaaaaattaggtccaggatgtacacaccta
aaagtaggtcaaagagtttgtttagcttgattacatgatgcatgtggacactgtgaattt
tgtttaacaggtaaagaaacattatgtcctaaccaaaatatgtcagcatatacaaaagat
ggatcatttgcagaatatgcaattggacatgaagattatgttggtgttgttccaaaagac
ttagacattattacgggagcgccagttgtttgtgctggggttacaacatataaagcagtt
aaacaagctaaactaaaaccaggtgaatatgttgcagttattggagttggtggattaggg
caaatggcagttcaatacgccaaagcaatgggttaccgtccaattggaattgacctaagt
gatgaaaaatgtaaattagcaattaaatcaggagctgaatatgctttcaactctaaaaaa
gtagatgttgttgctaaagttctagaagtaacaaatggtggagttcatggtgtaattaat
acatcagtagcaacagcagcagctgttcaaggaatgagtattctacgtagaggtggtcgc
caagttttagttggattacctgctaaagactcacacggtaaagatgaatttccagtttca
gtattttgaactgttctatgcgaaagagaattggctggttcaatagtagggacacgtaaa
gacctagctgaagcattagactatgcagcaagaggattagtaaaatcagaagtaacaaaa
gttattaaacttgaagaagttgcaagcatctttgaaaagctagaaaaaggcgaattctta
ggtagagcagtaattgattacagaaaataa

DBGET integrated database retrieval system