KEGG   Mycoplasma crocodyli: MCRO_0712Help
Entry
MCRO_0712         CDS       T01205                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mcd  Mycoplasma crocodyli
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MCRO_0712
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MCRO_0712
Enzymes [BR:mcd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MCRO_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(843336..847880)
Genome map
AA seq 1514 aa AA seqDB search
MNKKKLLTIVSVSSIIGVMGASVVALSATPEPKTVPAERVNLLTGKTKVTSDDQEGPFPA
TSAIDNDRYSRWSTNQKTSTKNNPHWIKVDMETPQTVKSFNILFERNNIRHFKLYLSATD
ADINKSESLVYDSNEMSGSQIKSEYRMDLSTEKTGVRFAKLVIQDWTSQGGGINYANTGV
VSFELFNSYFKKNVAYSTTLNNLAKGKTATASNNETGNTPNKTVDGDEKTRWATERNESS
AVPNGHFLMLDLGKQEKIRSFSLLLERNNISEFEIYASNTKADLETATTMKTKLIYSQIR
EANSEKLEEYKYNFTVPVTAQFIKVLFKKWDAGNNKWPNVSVREFSLYDQEIDTHNILED
LATLDNLQLNAEQTKLIIPTVPAGYVLKYLGTDYEQIIDKNLNVHKPLTEKTVKVDFELT
QTATGKITKLYNKPVKVPGLHTQEAAKNKKPNLIPELAEWYSDSTEKLELGDNLKVYYKG
DKDVNSTRMLNELIADYKEVTNKTITLEESPADESIIKGALIIDLTKKEIPGYDKETYGM
EIKDNIKINATNSIGAYWATRTFLQILKLDETHSKIEKGLIKDYPKYRLRGVSIDVGRKP
MSIEMLKNFVKELSWYKMNSLQVHLSDNLIWLEDHVPSKDKEGMEKAFDAYSAWRLESTV
KNNEGKTVTADDFYYTKEQFVEFINYSRELGIEIVPELDVPAHALSVTKIFKEFALMEFG
GHGGGRRPLIDHIDIRKPEAITLIKKLLDEYIDKDGIFSKDKGITVHIGADEFEGSPDSY
YDFCNIMFQHFKDKGVQVRIWGGFSRIKSSTKSINKELAKDVEMNLWSNDWSKPMDMYDY
GYKVINTLDQPGYMVPNGGGGRGVYQDYLSTQNIYNTWEANVAAGAHLPAASDQMLGGAF
AIWGDALLDTHATGLNELDLHTSLMDALPVYGLKLWGNGNDGNDLDWTKFQTLNEKIGIS
PNDDSLKIRKVEADRRQLFNFDFKGKTDNEKLFDKAGTYKLITNLNNATLVKDSADSYLQ
LNGGNSSADLPIGILGFNNKIKFRVKRQAAPANQKEEILFSAKSEYGEFAIKAKQKYTGK
FGFSRENMDYSFNYELPLDQWVEIELVCIPQGTKRGKTKLFVNGTETGGEAVGRNGYKWN
NGTKTDEVTFKNSTFFMPLEKIGSSSNSFKGQISNISQTNEWSKADKTELQRLESINLTV
KGPRLQPDKITNSQLVVSGNDSSKETVTSKIIEANNQESYIIVRETITSVSSPTDKIVRD
ILVDIEQDFPTMFETQIKIEEDHYTEASVKTFKTEIAKIDKSTLTTKSEYDKAITTVNSE
KTKLVENKALIIKDIEDTKGTDLSIYSQESVDKYLSALEKQKGILENKQHITRTEYTSEK
TNLVDHKKLLIENKVVAKQKVEAKEQEVKKEEYTPESLAKYEEEIKKLNEKINNKTSMTK
EEEKAIEEELNLIQKALVKKSTSPETPTTPVEPTTAPKKKLSGGAITAIVLSTLLGFGVV
AAIILFIIKRKKDK
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagaaacttttaactattgttagtgtttcatcaataataggggtgatgggt
gcttcagtggtagcgctttctgcaacaccagaaccaaaaactgttccagcagaaagagta
aatttattaaccggcaaaacaaaggttaccagtgatgatcaggaaggaccttttccagca
acttctgcaatagataatgatagatattcaaggtgatcaacaaaccaaaagacttcaacg
aaaaataatccacattgaattaaggtggatatggaaacaccacaaacagttaaatcattt
aacattttgtttgaaagaaataacataaggcattttaaactttatttatcagcaacagat
gcagatattaataaatcagaatcactggtttatgattctaatgaaatgagtggaagtcaa
atcaaatcagaatatagaatggatttatctaccgaaaaaacaggagttcgctttgctaaa
cttgtaattcaagattgaacttcgcaaggtggaggaataaactatgctaacaccggagtt
gtgtcttttgaattgtttaattcttatttcaaaaaaaacgttgcttattccacaacatta
aataatcttgctaaaggaaaaaccgctactgcaagtaataatgaaacagggaatacacct
aataaaactgttgatggtgacgaaaaaacaagatgagcaacagaacgcaatgaatcatca
gccgttcctaatgggcatttcttaatgcttgatttaggaaaacaagaaaaaataagatca
tttagtttgttgcttgaaagaaacaacatttcagagtttgaaatttatgcaagtaataca
aaagcagatttagaaacagcaacaacaatgaaaactaaattaatttactctcaaattaga
gaagcaaattcagaaaaattagaagagtataaatacaattttacagttcctgttactgct
caatttataaaagtattatttaaaaaatgagatgcgggtaataataaatgacctaatgtt
agtgtgagagaattttcactttatgatcaagaaattgacacacataatattttagaagat
ttagcaacattagacaatttacaattaaatgccgaacaaacaaagttgattattccaacc
gttcctgcgggttatgtattaaaatatttgggaactgattatgaacaaatcattgacaaa
aatttaaatgtacataagccattaactgaaaaaacagtaaaagttgattttgaactcact
caaacagctacaggtaaaattacaaaactttataacaaaccagtaaaagtacctggatta
cacactcaagaagcagcaaaaaataagaaacctaacctaattcctgaacttgctgaatga
tattctgattcaacagaaaaattagaattaggagacaaccttaaagtttattataaaggt
gataaagatgtaaactctacaagaatgttaaatgaattaatagctgattacaaagaagta
actaataaaacaattactttagaagaatcgcctgctgatgaatcaataattaagggtgca
ttaattattgatttgacaaaaaaagaaattcctggttatgataaagaaacttatggtatg
gaaatcaaagataacattaagattaatgcaacaaattcaattggagcttattgagcaaca
agaacatttttacaaattttaaaattagatgaaactcactcaaaaattgaaaaaggatta
ataaaagattatccaaaatatagattaagaggagtaagtattgatgttggtagaaaacct
atgtcgatcgaaatgcttaaaaactttgttaaagaattatcttgatacaagatgaattca
ttacaagttcacttaagcgataacttaatttgacttgaagatcacgtgccttcaaaagat
aaagaaggtatggaaaaagcatttgatgcttattcagcttgaagacttgaatcgactgta
aaaaataacgaaggtaaaacagttactgctgacgacttctactacacaaaagaacaattt
gttgaattcatcaattattcaagagaacttggaattgaaatagttcctgagcttgacgtt
ccagctcatgccttatcagtaacaaaaatatttaaagaatttgcgcttatggaatttggt
ggtcacggtggtggtcgaagaccattaatagatcacattgatattagaaaaccggaagca
ataactttaattaaaaaactattagatgagtatattgataaagatggaatctttagtaaa
gataaagggatcactgttcatataggagctgacgagtttgaaggatctcctgattcatac
tatgatttttgcaatattatgttccaacactttaaagataaaggtgtccaagttagaatt
tgaggtgggttttctagaataaaaagttcaacaaaatcgataaataaagaacttgcaaaa
gatgttgaaatgaacttatgatcaaacgattgatctaaacctatggacatgtatgattat
ggatataaagtaattaatactcttgatcaacctggttatatggttcctaacggaggtggc
ggaagaggagtttatcaagactacctttcaacccaaaatatatataacacttgagaagca
aatgttgcggctggagcacatttaccagcagcatcagatcaaatgttaggtggagcattt
gctatatgaggtgatgctttacttgacacacatgctacaggattaaatgaacttgattta
catacaagtttaatggatgcattgcctgtttatggattaaaactatgaggaaacggtaat
gatggaaacgatttagattgaactaaattccaaacgttaaatgaaaaaatcggaatttca
ccaaatgatgattcactaaaaataagaaaagttgaagctgatagaagacaattatttaat
tttgattttaaaggtaaaacagataatgaaaaattatttgataaagcaggaacatataaa
ttaattactaatttaaataatgctactcttgtaaaagattctgctgattcatatctacaa
ttaaatggtggtaattcatcagcagacttgcctataggtatattaggatttaataataaa
attaaatttagagtaaaaagacaagcggcaccagcaaatcaaaaggaagaaattttattt
tctgctaaatctgaatatggtgaatttgctattaaagcaaaacaaaaatacacaggaaaa
tttggatttagtagagaaaacatggactattcatttaattatgaactaccattagatcag
tgagttgaaattgaattagtatgtattccacaaggaactaaacgtggtaaaactaaatta
tttgtaaatggaaccgaaaccgggggagaagcggttggaagaaatggatacaaatgaaat
aacggaacaaaaacagatgaagttacatttaaaaacagcacattctttatgcctcttgaa
aaaattggttcatcttcaaattcatttaaaggtcaaataagcaacatatcgcaaactaac
gaatgatcaaaagctgataaaacagaattacaaagattagaatcaattaatttaacagta
aaaggtccaagattacaaccagataaaataactaattctcagcttgttgtttcaggaaat
gattcatcaaaagaaacagtaacatcaaaaattattgaagcaaacaatcaagaatcatac
attatagttagagaaacgattacttctgtttcttcaccaacagataaaattgttagagat
attttggttgatattgaacaagattttccaacaatgtttgaaactcaaattaaaattgaa
gaagatcattatacagaagcttctgttaaaacgtttaaaacagaaatagctaaaatagat
aaatctactttaacaaccaaaagtgaatatgataaagcaataacaactgttaattctgaa
aagacaaaacttgttgaaaacaaagcattaattattaaagatattgaagataccaaagga
acggatctgtcaatatattctcaagaatcggttgataaatatctttcagccttagaaaaa
caaaaaggcatcttagaaaataaacaacatattacaagaactgaatatactagtgaaaaa
actaatttagtcgatcataaaaaattacttattgaaaataaagttgttgcaaaacaaaag
gttgaagcaaaagaacaagaagttaaaaaagaagaatatacacctgagtcattagcaaaa
tatgaagaagaaattaaaaagctaaatgaaaaaataaataataaaacttcaatgactaaa
gaagaagaaaaagccattgaagaagaattaaacttaattcaaaaagctttagttaaaaaa
tctacttctcctgaaactccgaccactccagtagaacctacaactgctcctaagaagaag
ttgtcaggaggtgctataactgctatagtattgtcaacattactaggatttggtgttgta
gcagcaatcattctatttatcataaaaagaaaaaaagataaataa

DBGET integrated database retrieval system