KEGG   Mycoplasma crocodyli: MCRO_0733Help
Entry
MCRO_0733         CDS       T01205                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mcd  Mycoplasma crocodyli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCRO_0733 (recR)
DNA repair and recombination proteins [BR:mcd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MCRO_0733 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(876303..876884)
Genome map
AA seq 193 aa AA seqDB search
MENNPINNLISLVKNIDTVSKRQAEKIVSWIINCPKEQINELVSAINLVKTNINKCSICT
NLTTNEVCEICTSEDRDNILMVVENFNNIKKIEENEIFNGKYFVFSELIKPKKTSQDIEK
KAEELAQFSANFDEVILAISPTLEGEITNEFLRKYLKNRKINVSSISIGIPVGANIDYID
SISLKQSIINRRK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataacccaattaataatttaattagtttagttaagaatatagataccgtctca
aaaagacaagctgaaaaaatagttagttggataatcaattgtccgaaagaacaaatcaat
gaattagtaagcgctattaatttagttaaaacaaatattaacaagtgttcaatttgtaca
aatttaacaactaacgaagtgtgtgaaatttgtacaagtgaagatagagataatatatta
atggttgttgaaaactttaacaacataaaaaaaattgaagaaaatgaaatatttaatgga
aaatattttgtgttcagtgaactaattaagccgaaaaaaacaagtcaagacattgaaaag
aaggctgaggaactagctcaattttcagctaactttgatgaagtaattcttgcgataagt
ccaacacttgaaggtgaaataaccaacgagtttttaaggaaatatttgaaaaacagaaaa
attaatgtaagctcaatttcaattggtattccggttggagcaaatattgattatattgat
agtatttcactaaaacaatcaataataaatagaaggaagtaa

DBGET integrated database retrieval system