KEGG   Mycoplasma crocodyli: MCRO_0777Help
Entry
MCRO_0777         CDS       T01205                                 

Gene name
recD
Definition
deoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcd  Mycoplasma crocodyli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCRO_0777 (recD)
Enzymes [BR:mcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCRO_0777 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(931929..934097)
Genome map
AA seq 722 aa AA seqDB search
MSEQIKFKGVFYRKQAGGEDKGWALFLSRDDSTGKSYAVFTTKFFPKLRVPYEIVLQKNK
RDSFNLISFVEVLPDLYGNLERFLSSSIPSIGKVTAQKIVEKYGEDFLEKISDDPNMEIP
ELSEKQREELNSFLPQHDKQDIDFFTSNDLFYFYETLKSKIKPSKGSYIKEYKFKNPYSL
FFENNMNIFDVDKFAILLGNVNEKSFNRFEAFIYFSIKELEIDNNTVYRITDIFTELSKH
LEIDYNTFTDLFIEAINKKVIKKITYKNHDYFSLYSTFIKEEFIYGFLLEINSGSDEKVS
NYKSSKLDEFQEKAFINAVTKNVSIISGGPGTGKTFLIKELVDYFVSKGAKYGDQIKILT
PTGRVSSNITKKSGYAASTIHSYLSISKDDEEIPAFIAENMIEKWNALETLIIDEFSMVN
INIFYKLLTNCQYIKKIIIIGDAHQLPAIGPGNLLNDLIETNKFATYFLHNNHRSESTEI
FNHYSALNKDETPPFKKDVIDIIDEDDLSNDFISTYKKEVKEKGLENVIVLSPVYSGKYG
LIELNKKLQEVLNNSSETIITKKERGIIVNYKINDRVIQTVNRNNEGIYNGDFGYIKSFG
KKENDKGEFVNQISVEFNNIDNSKKVISYTENEFKQEIVLAYAVSIHKFQGSEVDTLFYI
VNKAHQTMNRKKLVYTGISRAKKHLFIVGSVNYYLQLIHNFKFEISDVKTHIKIETQKNK
GI
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaaattaagtttaaaggagttttctatagaaaacaagcaggtggtgaagat
aaagggtgagcactttttctctccagagatgatagtaccggcaaaagttatgctgttttt
actacaaaatttttcccaaaacttagagttccttacgaaatagttttgcaaaaaaacaaa
agagattcatttaatttaatttcatttgttgaggttcttccggatctttacggtaactta
gaaagatttttaagttcatcaattccttcgatagggaaagttactgcacaaaaaattgtc
gaaaaatacggtgaagattttctagaaaaaataagtgatgatccaaatatggaaattcct
gaattatcagaaaaacaaagagaagaactaaacagttttttgccgcaacatgacaaacaa
gatattgatttttttacttctaatgatttattttatttttatgaaactttaaaatctaaa
atcaaaccttcgaaaggttcttatataaaagaatataaatttaaaaatccttatagttta
ttttttgaaaacaacatgaacatttttgatgttgacaaatttgcaattttattaggaaac
gtcaatgagaaatcatttaatagatttgaagcttttatttatttttcaataaaagaatta
gaaatagataataatactgtttatagaataactgatatttttaccgaattatcaaaacat
cttgaaatagattacaacacttttaccgatttatttattgaggcaattaacaaaaaggtt
attaaaaaaattacatataaaaatcatgattacttttcactttattcaacttttattaaa
gaagaatttatttatggatttttgttagaaataaattcaggaagtgatgaaaaagtaagt
aattataaaagttcaaaattagatgaatttcaagaaaaagcatttataaacgctgtaaca
aaaaatgtttcaatcatttctggtggaccgggtacgggtaaaacatttttaattaaagaa
ctggttgattactttgtttctaaaggtgcaaaatatggagatcaaattaagatcttgaca
ccaacaggaagagtatcttcaaatatcaccaaaaaaagtggttatgcagcaagtactatt
catagttatctttcaataagtaaagatgatgaagaaattcctgcttttattgcagagaat
atgattgaaaaatgaaatgcattagaaactttaattattgatgaattttcaatggttaat
ataaatattttttacaaactattaacaaattgtcaatatataaagaagattattataatt
ggtgacgctcaccaattaccagcaattggtcctggtaatttattaaacgacttaattgaa
acgaataaattcgcaacatattttttacacaataatcatagaagtgaatcgacagaaata
ttcaatcactattctgctttaaacaaagatgaaaccccaccatttaaaaaagatgttatt
gatattattgatgaagatgacttatctaatgatttcatatctacttataaaaaagaagtt
aaagaaaaaggactagagaacgtaatagttctatcgcccgtttattcaggtaaatatggg
ttaatagaattaaataaaaaattacaagaagtattgaacaattcttctgaaactataata
actaagaaagaacgcggaattattgtaaattataaaatcaatgacagggttattcaaaca
gttaatagaaacaatgaaggaatttataatggtgattttggttatataaaatcttttgga
aaaaaagaaaatgataaaggagaatttgttaatcaaattagtgttgagtttaataatata
gataattcaaaaaaagtaatttcatatactgaaaatgaatttaaacaagaaattgtttta
gcttatgctgtttctattcataagtttcaaggtagcgaagttgatacattattttacata
gttaataaagcccaccaaacaatgaatagaaaaaaacttgtttatactggtatatcaaga
gccaaaaaacacttgttcatagtaggaagtgtgaattattatcttcaactaattcacaat
tttaagtttgaaatatcagatgttaaaacacatatcaaaatagaaacacaaaaaaataaa
ggaatataa

DBGET integrated database retrieval system